You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameOrnithine carbamoyltransferase
Synonyms
  • Ornithine transcarbamylase
  • OTCase
Gene NameARG3
Enzyme Class
Biological Properties
General FunctionInvolved in carboxyl- or carbamoyltransferase activity
Specific FunctionCarbamoyl phosphate + L-ornithine = phosphate + L-citrulline
Cellular LocationCytoplasm
SMPDB PathwaysNot Available
KEGG Pathways
Arginine and proline metabolismec00330 Map00330
SMPDB ReactionsNot Available
KEGG Reactions
Ornithine + CarbamoylphosphateCitrulline + phosphate + hydron
Metabolites
YMDB IDNameView
YMDB00060CitrullineShow
YMDB00082CarbamoylphosphateShow
YMDB00353OrnithineShow
YMDB00862hydronShow
YMDB00907phosphateShow
GO Classification
Component
macromolecular complex
protein complex
ornithine carbamoyltransferase complex
Function
carboxylic acid binding
amino acid binding
carboxyl- or carbamoyltransferase activity
ornithine carbamoyltransferase activity
catalytic activity
transferase activity
transferase activity, transferring one-carbon groups
binding
Process
metabolic process
cellular metabolic process
cellular amino acid and derivative metabolic process
cellular amino acid metabolic process
Gene Properties
Chromosome Locationchromosome 10
LocusYJL088W
Gene Sequence>1017 bp ATGTCAACCACAGCATCCACGCCTTCATCTTTACGTCATTTGATTTCTATAAAAGATCTT TCTGATGAAGAATTCAGAATCTTAGTACAAAGAGCTCAACATTTCAAGAATGTTTTTAAA GCAAATAAAACGAATGATTTCCAATCCAACCATCTGAAACTATTGGGTAGAACTATAGCC TTAATATTTACTAAAAGATCAACTAGAACGAGAATTTCGACCGAAGGTGCAGCCACCTTC TTTGGTGCCCAACCGATGTTTTTAGGTAAAGAGGATATTCAGCTTGGTGTCAATGAATCA TTTTACGATACCACCAAGGTTGTATCATCTATGGTTTCATGTATTTTTGCCCGTGTGAAC AAACATGAAGACATACTTGCTTTTTGCAAGGATTCCTCTGTACCGATCATCAACTCTCTA TGTGACAAATTCCACCCTTTGCAAGCAATTTGTGATCTTTTAACAATAATCGAAAACTTC AATATATCTCTAGATGAAGTAAATAAGGGAATCAATTCAAAATTGAAGATGGCATGGATT GGTGATGCCAATAATGTCATAAATGATATGTGCATCGCATGTCTGAAATTCGGTATAAGT GTCAGTATTTCCACTCCCCCCGGTATTGAAATGGATTCCGATATTGTCGATGAAGCAAAG AAAGTTGCTGAGAGAAACGGTGCGACATTTGAATTAACACACGACTCTTTAAAGGCCTCC ACCAATGCCAATATATTAGTAACCGATACTTTCGTTTCCATGGGTGAAGAATTTGCGAAA CAGGCCAAGCTGAAACAATTCAAAGGTTTTCAAATCAATCAAGAACTTGTCTCTGTGGCT GATCCAAACTACAAATTTATGCATTGTCTGCCAAGACATCAAGAAGAAGTTAGTGATGAT GTCTTTTATGGAGAGCATTCCATAGTCTTTGAAGAAGCAGAAAACAGATTATATGCAGCT ATGTCTGCCATTGATATCTTTGTTAATAATAAAGGTAATTTCAAGGACTTGAAATAA
Protein Properties
Pfam Domain Function
Protein Residues338
Protein Molecular Weight37844.80078
Protein Theoretical pI6.24
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Ornithine carbamoyltransferase MSTTASTPSSLRHLISIKDLSDEEFRILVQRAQHFKNVFKANKTNDFQSNHLKLLGRTIA LIFTKRSTRTRISTEGAATFFGAQPMFLGKEDIQLGVNESFYDTTKVVSSMVSCIFARVN KHEDILAFCKDSSVPIINSLCDKFHPLQAICDLLTIIENFNISLDEVNKGINSKLKMAWI GDANNVINDMCIACLKFGISVSISTPPGIEMDSDIVDEAKKVAERNGATFELTHDSLKAS TNANILVTDTFVSMGEEFAKQAKLKQFKGFQINQELVSVADPNYKFMHCLPRHQEEVSDD VFYGEHSIVFEEAENRLYAAMSAIDIFVNNKGNFKDLK
References
External Links
ResourceLink
Saccharomyces Genome Database ARG3
Uniprot IDP05150
Uniprot NameOTC_YEAST
GenBank Gene IDM11946
Genebank Protein ID171075
General Reference
  • Huygen, R., Crabeel, M., Glansdorff, N. (1987). "Nucleotide sequence of the ARG3 gene of the yeast Saccharomyces cerevisiae encoding ornithine carbamoyltransferase. Comparison with other carbamoyltransferases." Eur J Biochem 166:371-377.3038540
  • Miosga, T., Schaaff-Gerstenschlager, I., Chalwatzis, N., Baur, A., Boles, E., Fournier, C., Schmitt, S., Velten, C., Wilhelm, N., Zimmermann, F. K. (1995). "Sequence analysis of a 33.1 kb fragment from the left arm of Saccharomyces cerevisiae chromosome X, including putative proteins with leucine zippers, a fungal Zn(II)2-Cys6 binuclear cluster domain and a putative alpha 2-SCB-alpha 2 binding site." Yeast 11:681-689.7483841
  • Galibert, F., Alexandraki, D., Baur, A., Boles, E., Chalwatzis, N., Chuat, J. C., Coster, F., Cziepluch, C., De Haan, M., Domdey, H., Durand, P., Entian, K. D., Gatius, M., Goffeau, A., Grivell, L. A., Hennemann, A., Herbert, C. J., Heumann, K., Hilger, F., Hollenberg, C. P., Huang, M. E., Jacq, C., Jauniaux, J. C., Katsoulou, C., Karpfinger-Hartl, L., et, a. l. .. (1996). "Complete nucleotide sequence of Saccharomyces cerevisiae chromosome X." EMBO J 15:2031-2049.8641269
  • Crabeel, M., Huygen, R., Verschueren, K., Messenguy, F., Tinel, K., Cunin, R., Glansdorff, N. (1985). "General amino acid control and specific arginine repression in Saccharomyces cerevisiae: physical study of the bifunctional regulatory region of the ARG3 gene." Mol Cell Biol 5:3139-3148.3915770
  • El Alami, M., Dubois, E., Oudjama, Y., Tricot, C., Wouters, J., Stalon, V., Messenguy, F. (2003). "Yeast epiarginase regulation, an enzyme-enzyme activity control: identification of residues of ornithine carbamoyltransferase and arginase responsible for enzyme catalytic and regulatory activities." J Biol Chem 278:21550-21558.12679340
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106