You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameDNA ligase 1
Synonyms
  • DNA ligase I
  • Polydeoxyribonucleotide synthase [ATP] 1
Gene NameCDC9
Enzyme Class
Biological Properties
General FunctionInvolved in DNA ligase (ATP) activity
Specific FunctionDNA ligase that seals nicks in double-stranded DNA during DNA replication, DNA recombination and DNA repair. The mitochondrial form is required for mitochondrial DNA maintenance but is non-essential while the nuclear form is essential for cell viability
Cellular LocationNucleus. Mitochondrion
SMPDB PathwaysNot Available
KEGG PathwaysNot Available
SMPDB ReactionsNot Available
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB00097Adenosine monophosphateShow
GO Classification
Component
Not Available
Function
purine nucleoside binding
adenyl nucleotide binding
adenyl ribonucleotide binding
ATP binding
nucleic acid binding
DNA ligase (ATP) activity
catalytic activity
DNA binding
ligase activity, forming phosphoric ester bonds
DNA ligase activity
ligase activity
binding
nucleoside binding
Process
cellular macromolecule metabolic process
DNA metabolic process
DNA replication
metabolic process
macromolecule metabolic process
DNA ligation
DNA ligation involved in DNA repair
DNA recombination
DNA repair
Gene Properties
Chromosome Locationchromosome 4
LocusYDL164C
Gene Sequence>2268 bp ATGCGCAGATTACTGACCGGTTGCCTTCTTTCATCTGCACGTCCCTTGAAATCAAGATTG CCATTATTGATGTCATCCTCATTACCTTCCTCTGCCGGTAAGAAGCCTAAACAAGCCACT TTGGCTAGATTCTTCACTTCCATGAAAAATAAGCCAACAGAAGGTACTCCTTCTCCCAAA AAATCATCCAAACATATGCTGGAAGATAGAATGGATAATGTTAGTGGGGAAGAGGAATAC GCGACCAAGAAATTGAAACAGACGGCTGTTACACATACTGTAGCAGCTCCAAGCTCCATG GGTAGCAATTTTTCTTCTATACCATCATCCGCTCCCTCTTCCGGTGTTGCTGATTCACCG CAACAATCTCAGAGGTTGGTAGGTGAAGTTGAAGACGCCTTGAGCTCAAATAATAATGAT CACTATTCGTCTAATATCCCCTATTCTGAAGTTTGTGAGGTTTTTAACAAGATTGAGGCC ATATCTTCCCGTTTAGAGATTATAAGAATCTGTTCTGATTTCTTTATTAAGATAATGAAG CAATCGTCTAAGAACTTAATACCTACAACATACCTTTTCATCAATAGATTGGGCCCTGAC TACGAAGCAGGCTTGGAATTAGGCCTTGGAGAAAATCTTCTTATGAAAACCATAAGCGAA ACTTGCGGGAAATCCATGAGCCAAATTAAACTTAAATACAAGGATATTGGGGATTTGGGT GAAATAGCAATGGGTGCGAGAAATGTCCAACCCACTATGTTTAAGCCCAAACCCTTGACC GTGGGTGAGGTCTTCAAAAATCTTAGAGCTATTGCTAAGACTCAGGGCAAAGATTCACAA TTAAAAAAGATGAAGCTGATCAAGAGAATGCTTACTGCTTGCAAAGGTATAGAGGCTAAG TTTTTGATTAGATCCCTAGAGTCAAAATTGAGAATCGGTCTTGCTGAAAAGACTGTCTTA ATATCCCTATCGAAGGCTCTTTTGCTCCATGATGAAAATAGGGAGGACTCTCCAGACAAA GATGTCCCCATGGATGTGTTAGAAAGTGCTCAACAAAAGATAAGAGACGCATTTTGTCAA GTACCCAACTATGAAATTGTTATAAACTCATGCCTGGAACACGGTATTATGAATTTAGAT AAATATTGTACTCTAAGACCAGGAATTCCATTGAAACCCATGTTAGCCAAGCCTACCAAG GCAATTAATGAAGTATTGGATAGATTTCAAGGCGAAACTTTTACGTCAGAATACAAATAC GATGGTGAAAGGGCTCAGGTGCATTTACTAAATGATGGTACAATGAGGATTTATTCCAGA AATGGCGAGAATATGACTGAGAGATATCCAGAAATTAACATAACGGATTTTATCCAGGAT TTGGATACTACCAAAAATTTAATTCTAGACTGTGAGGCTGTTGCTTGGGACAAAGATCAG GGGAAAATTTTGCCTTTCCAGGTCTTAAGTACAAGGAAACGTAAAGACGTGGAGCTGAAT GATGTTAAAGTTAAAGTCTGTCTCTTTGCATTTGATATACTTTGCTACAACGATGAAAGG CTGATTAATAAGTCACTAAAGGAAAGAAGAGAATACTTGACGAAGGTTACAAAAGTTGTC CCGGGAGAATTCCAATACGCGACTCAGATAACAACAAATAACCTTGATGAACTTCAAAAA TTCCTTGATGAGTCCGTTAATCACTCATGCGAAGGTTTGATGGTCAAAATGTTGGAGGGC CCTGAATCCCATTATGAACCAAGTAAAAGGTCAAGAAACTGGTTGAAATTAAAAAAAGAT TACTTGGAGGGGGTTGGAGATTCATTGGATCTCTGCGTGTTGGGGGCATATTATGGTAGA GGAAAAAGAACTGGTACGTACGGTGGGTTCCTTCTAGGATGTTACAACCAAGACACAGGA GAATTTGAAACTTGTTGCAAGATAGGGACAGGATTTTCGGACGAAATGTTGCAGCTTTTG CACGACAGGTTGACCCCGACGATCATTGATGGACCAAAAGCCACGTTTGTTTTCGATTCG AGTGCTGAGCCAGATGTATGGTTCGAACCTACGACTTTGTTTGAAGTTTTGACTGCAGAC CTTTCCCTATCGCCTATTTATAAAGCAGGTAGTGCAACTTTTGATAAGGGCGTATCCTTA AGATTTCCAAGATTTTTGCGTATAAGAGAAGACAAGGGCGTAGAAGATGCAACCTCTTCT GACCAGATCGTCGAATTGTATGAAAACCAATCCCACATGCAAAATTAG
Protein Properties
Pfam Domain Function
Protein Residues755
Protein Molecular Weight84827.39844
Protein Theoretical pI7.56
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>DNA ligase 1 MRRLLTGCLLSSARPLKSRLPLLMSSSLPSSAGKKPKQATLARFFTSMKNKPTEGTPSPK KSSKHMLEDRMDNVSGEEEYATKKLKQTAVTHTVAAPSSMGSNFSSIPSSAPSSGVADSP QQSQRLVGEVEDALSSNNNDHYSSNIPYSEVCEVFNKIEAISSRLEIIRICSDFFIKIMK QSSKNLIPTTYLFINRLGPDYEAGLELGLGENLLMKTISETCGKSMSQIKLKYKDIGDLG EIAMGARNVQPTMFKPKPLTVGEVFKNLRAIAKTQGKDSQLKKMKLIKRMLTACKGIEAK FLIRSLESKLRIGLAEKTVLISLSKALLLHDENREDSPDKDVPMDVLESAQQKIRDAFCQ VPNYEIVINSCLEHGIMNLDKYCTLRPGIPLKPMLAKPTKAINEVLDRFQGETFTSEYKY DGERAQVHLLNDGTMRIYSRNGENMTERYPEINITDFIQDLDTTKNLILDCEAVAWDKDQ GKILPFQVLSTRKRKDVELNDVKVKVCLFAFDILCYNDERLINKSLKERREYLTKVTKVV PGEFQYATQITTNNLDELQKFLDESVNHSCEGLMVKMLEGPESHYEPSKRSRNWLKLKKD YLEGVGDSLDLCVLGAYYGRGKRTGTYGGFLLGCYNQDTGEFETCCKIGTGFSDEMLQLL HDRLTPTIIDGPKATFVFDSSAEPDVWFEPTTLFEVLTADLSLSPIYKAGSATFDKGVSL RFPRFLRIREDKGVEDATSSDQIVELYENQSHMQN
References
External Links
ResourceLink
Saccharomyces Genome Database CDC9
Uniprot IDP04819
Uniprot NameDNLI1_YEAST
GenBank Gene IDAY723764
Genebank Protein ID51830214
General Reference
  • Barker, D. G., White, J. H., Johnston, L. H. (1985). "The nucleotide sequence of the DNA ligase gene (CDC9) from Saccharomyces cerevisiae: a gene which is cell-cycle regulated and induced in response to DNA damage." Nucleic Acids Res 13:8323-8337.3909103
  • Jacq, C., Alt-Morbe, J., Andre, B., Arnold, W., Bahr, A., Ballesta, J. P., Bargues, M., Baron, L., Becker, A., Biteau, N., Blocker, H., Blugeon, C., Boskovic, J., Brandt, P., Bruckner, M., Buitrago, M. J., Coster, F., Delaveau, T., del Rey, F., Dujon, B., Eide, L. G., Garcia-Cantalejo, J. M., Goffeau, A., Gomez-Peris, A., Zaccaria, P., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome IV." Nature 387:75-78.9169867
  • Hu, Y., Rolfs, A., Bhullar, B., Murthy, T. V., Zhu, C., Berger, M. F., Camargo, A. A., Kelley, F., McCarron, S., Jepson, D., Richardson, A., Raphael, J., Moreira, D., Taycher, E., Zuo, D., Mohr, S., Kane, M. F., Williamson, J., Simpson, A., Bulyk, M. L., Harlow, E., Marsischky, G., Kolodner, R. D., LaBaer, J. (2007). "Approaching a complete repository of sequence-verified protein-encoding clones for Saccharomyces cerevisiae." Genome Res 17:536-543.17322287
  • Wehner, E. P., Rao, E., Brendel, M. (1993). "Molecular structure and genetic regulation of SFA, a gene responsible for resistance to formaldehyde in Saccharomyces cerevisiae, and characterization of its protein product." Mol Gen Genet 237:351-358.8483449
  • Willer, M., Rainey, M., Pullen, T., Stirling, C. J. (1999). "The yeast CDC9 gene encodes both a nuclear and a mitochondrial form of DNA ligase I." Curr Biol 9:1085-1094.10531002
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Chi, A., Huttenhower, C., Geer, L. Y., Coon, J. J., Syka, J. E., Bai, D. L., Shabanowitz, J., Burke, D. J., Troyanskaya, O. G., Hunt, D. F. (2007). "Analysis of phosphorylation sites on proteins from Saccharomyces cerevisiae by electron transfer dissociation (ETD) mass spectrometry." Proc Natl Acad Sci U S A 104:2193-2198.17287358
  • Smolka, M. B., Albuquerque, C. P., Chen, S. H., Zhou, H. (2007). "Proteome-wide identification of in vivo targets of DNA damage checkpoint kinases." Proc Natl Acad Sci U S A 104:10364-10369.17563356
  • Albuquerque, C. P., Smolka, M. B., Payne, S. H., Bafna, V., Eng, J., Zhou, H. (2008). "A multidimensional chromatography technology for in-depth phosphoproteome analysis." Mol Cell Proteomics 7:1389-1396.18407956