You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameHexokinase-1
Synonyms
  • Hexokinase PI
  • Hexokinase-A
Gene NameHXK1
Enzyme Class
Biological Properties
General FunctionInvolved in ATP binding
Specific FunctionATP + D-hexose = ADP + D-hexose 6-phosphate
Cellular LocationNot Available
SMPDB Pathways
Amino sugar and nucleotide sugar metabolismPW002413 ThumbThumb?image type=greyscaleThumb?image type=simple
Ethanol fermentationPW002448 ThumbThumb?image type=greyscaleThumb?image type=simple
Fructose MetabolismPW002390 ThumbThumb?image type=greyscaleThumb?image type=simple
Mannose MetabolismPW002391 ThumbThumb?image type=greyscaleThumb?image type=simple
Starch and sucrose metabolismPW002481 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Amino sugar and nucleotide sugar metabolismec00520 Map00520
Fructose and mannose metabolismec00051 Map00051
Galactose metabolismec00052 Map00052
Glycolysis / Gluconeogenesisec00010 Map00010
Starch and sucrose metabolismec00500 Map00500
SMPDB Reactions
D-Fructose + Adenosine triphosphateBeta-D-Fructose 6-phosphate + Adenosine triphosphate + hydron
D-Mannose + Adenosine triphosphatehydron + ADP + Mannose 6-phosphate
Adenosine triphosphate + D-FructoseADP + Beta-D-Fructose 6-phosphate
Adenosine triphosphate + D-MannoseADP + Mannose 6-phosphate
KEGG Reactions
Adenosine triphosphate + D-FructoseFructose 6-phosphate + hydron + ADP
Adenosine triphosphate + D-Glucosealdehydo-D-glucose 6-phosphate + hydron + ADP
Adenosine triphosphate + D-MannoseD-mannose 6-phosphate + hydron + ADP
Metabolites
YMDB IDNameView
YMDB00072D-GalactoseShow
YMDB00078Fructose 6-phosphateShow
YMDB00109Adenosine triphosphateShow
YMDB00242Mannose 6-phosphateShow
YMDB00286D-GlucoseShow
YMDB00582aldehydo-D-glucose 6-phosphateShow
YMDB00655D-fructose 1-phosphateShow
YMDB00657D-FructoseShow
YMDB00862hydronShow
YMDB00894D-MannoseShow
YMDB00914ADPShow
YMDB00947Glucose 6-phosphateShow
YMDB00966D-mannose 6-phosphateShow
YMDB16176Beta-D-Fructose 6-phosphateShow
GO Classification
Component
Not Available
Function
transferase activity
hexokinase activity
transferase activity, transferring phosphorus-containing groups
binding
nucleoside binding
purine nucleoside binding
adenyl nucleotide binding
adenyl ribonucleotide binding
ATP binding
phosphotransferase activity, alcohol group as acceptor
catalytic activity
Process
hexose metabolic process
metabolic process
glucose metabolic process
glucose catabolic process
glycolysis
primary metabolic process
carbohydrate metabolic process
small molecule metabolic process
alcohol metabolic process
monosaccharide metabolic process
Gene Properties
Chromosome Locationchromosome 6
LocusYFR053C
Gene Sequence>1458 bp ATGGTTCATTTAGGTCCAAAGAAACCACAGGCTAGAAAGGGTTCCATGGCTGATGTGCCC AAGGAATTGATGGATGAAATTCATCAGTTGGAAGATATGTTTACAGTTGACAGCGAGACC TTGAGAAAGGTTGTTAAGCACTTTATCGACGAATTGAATAAAGGTTTGACAAAGAAGGGA GGTAACATTCCAATGATTCCCGGTTGGGTCATGGAATTCCCAACAGGTAAAGAATCTGGT AACTATTTGGCCATTGATTTGGGTGGTACTAACTTAAGAGTCGTGTTGGTCAAGTTGAGC GGTAACCATACCTTTGACACCACTCAATCCAAGTATAAACTACCACATGACATGAGAACC ACTAAGCACCAAGAGGAGTTATGGTCCTTTATTGCCGACTCTTTGAAGGACTTTATGGTC GAGCAAGAATTGCTAAACACCAAGGACACCTTACCATTAGGTTTCACCTTCTCGTACCCA GCTTCCCAAAACAAGATTAACGAAGGTATTTTGCAAAGATGGACCAAGGGTTTCGATATT CCAAATGTCGAAGGCCACGATGTCGTCCCATTGCTACAAAACGAAATTTCCAAGAGAGAG TTGCCTATTGAAATTGTAGCATTGATTAATGATACTGTTGGTACTTTAATTGCCTCATAC TACACTGACCCAGAGACTAAGATGGGTGTGATTTTCGGTACTGGTGTCAACGGTGCTTTC TATGATGTTGTTTCCGATATCGAAAAGTTGGAGGGCAAATTAGCAGACGATATTCCAAGT AACTCTCCAATGGCTATCAATTGTGAATATGGTTCCTTCGATAATGAACATTTGGTCTTG CCAAGAACCAAGTACGATGTTGCTGTCGACGAACAATCTCCAAGACCTGGTCAACAAGCT TTTGAAAAGATGACCTCCGGTTACTACTTGGGTGAATTGTTGCGTCTAGTGTTACTTGAA TTAAACGAGAAGGGCTTGATGTTGAAGGATCAAGATCTAAGCAAGTTGAAACAACCATAC ATCATGGATACCTCCTACCCAGCAAGAATCGAGGATGATCCATTTGAAAACTTGGAAGAT ACTGATGACATCTTCCAAAAGGACTTTGGTGTCAAGACCACTCTGCCAGAACGTAAGTTG ATTAGAAGACTTTGTGAATTGATCGGTACCAGAGCTGCTAGATTAGCTGTTTGTGGTATT GCCGCTATTTGCCAAAAGAGAGGTTACAAGACTGGTCACATTGCCGCTGACGGTTCTGTC TATAACAAATACCCAGGTTTCAAGGAAGCCGCCGCTAAGGGTTTGAGAGATATCTATGGA TGGACTGGTGACGCAAGCAAAGATCCAATTACGATTGTTCCAGCTGAGGATGGTTCAGGT GCAGGTGCTGCTGTTATTGCTGCATTGTCCGAAAAAAGAATTGCCGAAGGTAAGTCTCTT GGTATCATTGGCGCTTAA
Protein Properties
Pfam Domain Function
Protein Residues485
Protein Molecular Weight53737.89844
Protein Theoretical pI5.1
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Hexokinase-1 MVHLGPKKPQARKGSMADVPKELMDEIHQLEDMFTVDSETLRKVVKHFIDELNKGLTKKG GNIPMIPGWVMEFPTGKESGNYLAIDLGGTNLRVVLVKLSGNHTFDTTQSKYKLPHDMRT TKHQEELWSFIADSLKDFMVEQELLNTKDTLPLGFTFSYPASQNKINEGILQRWTKGFDI PNVEGHDVVPLLQNEISKRELPIEIVALINDTVGTLIASYYTDPETKMGVIFGTGVNGAF YDVVSDIEKLEGKLADDIPSNSPMAINCEYGSFDNEHLVLPRTKYDVAVDEQSPRPGQQA FEKMTSGYYLGELLRLVLLELNEKGLMLKDQDLSKLKQPYIMDTSYPARIEDDPFENLED TDDIFQKDFGVKTTLPERKLIRRLCELIGTRAARLAVCGIAAICQKRGYKTGHIAADGSV YNKYPGFKEAAAKGLRDIYGWTGDASKDPITIVPAEDGSGAGAAVIAALSEKRIAEGKSL GIIGA
References
External Links
ResourceLink
Saccharomyces Genome Database HXK1
Uniprot IDP04806
Uniprot NameHXKA_YEAST
GenBank Gene IDD50617
Genebank Protein ID836808
General Reference
  • Bennett, W. S. Jr, Steitz, T. A. (1980). "Structure of a complex between yeast hexokinase A and glucose. I. Structure determination and refinement at 3.5 A resolution." J Mol Biol 140:183-209.7001031
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Raushel, F. M., Cleland, W. W. (1973). "The substrate and anomeric specificity of fructokinase." J Biol Chem 248:8174-8177.4356621
  • Smolka, M. B., Albuquerque, C. P., Chen, S. H., Zhou, H. (2007). "Proteome-wide identification of in vivo targets of DNA damage checkpoint kinases." Proc Natl Acad Sci U S A 104:10364-10369.17563356
  • Murakami, Y., Naitou, M., Hagiwara, H., Shibata, T., Ozawa, M., Sasanuma, S., Sasanuma, M., Tsuchiya, Y., Soeda, E., Yokoyama, K., et, a. l. .. (1995). "Analysis of the nucleotide sequence of chromosome VI from Saccharomyces cerevisiae." Nat Genet 10:261-268.7670463
  • Eki, T., Naitou, M., Hagiwara, H., Ozawa, M., Sasanuma, S. I., Sasanuma, M., Tsuchiya, Y., Shibata, T., Hanaoka, F., Murakami, Y. (1996). "Analysis of a 36.2 kb DNA sequence including the right telomere of chromosome VI from Saccharomyces cerevisiae." Yeast 12:149-167.8686379
  • Chi, A., Huttenhower, C., Geer, L. Y., Coon, J. J., Syka, J. E., Bai, D. L., Shabanowitz, J., Burke, D. J., Troyanskaya, O. G., Hunt, D. F. (2007). "Analysis of phosphorylation sites on proteins from Saccharomyces cerevisiae by electron transfer dissociation (ETD) mass spectrometry." Proc Natl Acad Sci U S A 104:2193-2198.17287358
  • Stachelek, C., Stachelek, J., Swan, J., Botstein, D., Konigsberg, W. (1986). "Identification, cloning and sequence determination of the genes specifying hexokinase A and B from yeast." Nucleic Acids Res 14:945-963.3003701
  • Albuquerque, C. P., Smolka, M. B., Payne, S. H., Bafna, V., Eng, J., Zhou, H. (2008). "A multidimensional chromatography technology for in-depth phosphoproteome analysis." Mol Cell Proteomics 7:1389-1396.18407956
  • Kopetzki, E., Entian, K. D., Mecke, D. (1985). "Complete nucleotide sequence of the hexokinase PI gene (HXK1) of Saccharomyces cerevisiae." Gene 39:95-101.3908224
  • Li, X., Gerber, S. A., Rudner, A. D., Beausoleil, S. A., Haas, W., Villen, J., Elias, J. E., Gygi, S. P. (2007). "Large-scale phosphorylation analysis of alpha-factor-arrested Saccharomyces cerevisiae." J Proteome Res 6:1190-1197.17330950
  • Ficarro, S. B., McCleland, M. L., Stukenberg, P. T., Burke, D. J., Ross, M. M., Shabanowitz, J., Hunt, D. F., White, F. M. (2002). "Phosphoproteome analysis by mass spectrometry and its application to Saccharomyces cerevisiae." Nat Biotechnol 20:301-305.11875433
  • Tamura, J. K., LaDine, J. R., Cross, R. L. (1988). "The adenine nucleotide binding site on yeast hexokinase PII. Affinity labeling of Lys-111 by pyridoxal 5'-diphospho-5'-adenosine." J Biol Chem 263:7907-7912.3131329