Survey with prize
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameTryptophanyl-tRNA synthetase, mitochondrial
Synonyms
  • Tryptophan--tRNA ligase
  • TrpRS
Gene NameMSW1
Enzyme Class
Biological Properties
General FunctionInvolved in nucleotide binding
Specific FunctionATP + L-tryptophan + tRNA(Trp) = AMP + diphosphate + L-tryptophyl-tRNA(Trp)
Cellular LocationMitochondrion matrix
SMPDB Pathways
Tryptophan metabolismPW002442 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Tryptophan metabolismec00380 Map00380
SMPDB ReactionsNot Available
KEGG Reactions
Adenosine triphosphate + tRNA(Trp) + L-TryptophanAdenosine monophosphate + Pyrophosphate + Trp-tRNA(Trp)
Metabolites
YMDB IDNameView
YMDB00097Adenosine monophosphateShow
YMDB00109Adenosine triphosphateShow
YMDB00126L-TryptophanShow
YMDB00219PyrophosphateShow
GO Classification
Component
intracellular part
cytoplasm
cell part
Function
nucleoside binding
purine nucleoside binding
adenyl nucleotide binding
tryptophan-tRNA ligase activity
adenyl ribonucleotide binding
ATP binding
ligase activity, forming carbon-oxygen bonds
ligase activity, forming aminoacyl-tRNA and related compounds
catalytic activity
aminoacyl-tRNA ligase activity
nucleotide binding
ligase activity
binding
Process
tRNA aminoacylation for protein translation
macromolecule biosynthetic process
cellular macromolecule biosynthetic process
translation
tryptophanyl-tRNA aminoacylation
metabolic process
macromolecule metabolic process
cellular macromolecule metabolic process
RNA metabolic process
ncRNA metabolic process
biosynthetic process
tRNA metabolic process
tRNA aminoacylation
Gene Properties
Chromosome Locationchromosome 4
LocusYDR268W
Gene Sequence>1140 bp ATGTCGAATAAGCAGGCGGTTCTGAAGTTAATCAGTAAAAGGTGGATAAGCACAGTGCAA CGTGCCGATTTTAAGCTGAATTCCGAAGCGCTTCATAGTAATGCTACGGTATTTAGTATG ATTCAGCCAACTGGGTGTTTCCACCTTGGTAATTATCTAGGTGCTACACGTGTTTGGACA GACTTATGTGAATTAAAACAACCTGGCCAGGAATTGATATTTGGAGTTGCTGATTTACAC GCTATCACTGTTCCAAAGCCAGATGGAGAAATGTTTAGAAAATTTCGCCATGAGGCAGTA GCAAGTATACTGGCTGTCGGTGTAGATCCAGAAAAGGCTTCGGTGATCTACCAATCCGCC ATCCCTCAACACAGTGAATTACACTGGTTGCTTTCTACTCTTGCCTCGATGGGATTACTT AACCGCATGACGCAATGGAAATCAAAATCGAATATCAAACAATCAACTAATGGGGATTAT CTGGTTAACGATTCTGACGTGGGAAAAGTTAGACTGGGCTTATTTTCGTATCCTGTTTTA CAGGCAGCGGATATTCTACTTTATAAATCTACACACGTTCCTGTTGGCGATGATCAATCG CAGCATTTGGAACTAACAAGACACCTTGCTGAAAAGTTTAACAAAATGTACAAGAAAAAT TTTTTTCCTAAACCTGTAACTATGTTGGCACAAACGAAAAAAGTTTTGAGCTTAAGCACG CCTGAAAAGAAAATGTCCAAGAGTGATCCGAATCACGACTCTGTAATTTTTTTGAATGAT GAGCCTAAGGCAATTCAGAAAAAGATTAGAAAAGCTTTAACAGATTCCATTTCTGATAGG TTCTACTACGACCCTGTAGAAAGACCAGGCGTATCGAATTTAATTAACATTGTCAGTGGC ATTCAAAGAAAATCGATTGAAGATGTCGTAGAAGATGTATCTCGTTTCAATAACTATAGG GATTTCAAAGATTATGTTTCAGAAGTGATAATTGAGGAATTGAAAGGCCCAAGAACAGAA TTTGAGAAATATATCAACGAACCGACCTATTTGCATAGTGTCGTTGAATCTGGCATGCGC AAAGCGAGAGAAAAAGCAGCAAAAAACCTGGCCGACATTCATAAAATAATGGGCTTCTGA
Protein Properties
Pfam Domain Function
Protein Residues379
Protein Molecular Weight43015.10156
Protein Theoretical pI9.63
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Tryptophanyl-tRNA synthetase, mitochondrial MSNKQAVLKLISKRWISTVQRADFKLNSEALHSNATVFSMIQPTGCFHLGNYLGATRVWT DLCELKQPGQELIFGVADLHAITVPKPDGEMFRKFRHEAVASILAVGVDPEKASVIYQSA IPQHSELHWLLSTLASMGLLNRMTQWKSKSNIKQSTNGDYLVNDSDVGKVRLGLFSYPVL QAADILLYKSTHVPVGDDQSQHLELTRHLAEKFNKMYKKNFFPKPVTMLAQTKKVLSLST PEKKMSKSDPNHDSVIFLNDEPKAIQKKIRKALTDSISDRFYYDPVERPGVSNLINIVSG IQRKSIEDVVEDVSRFNNYRDFKDYVSEVIIEELKGPRTEFEKYINEPTYLHSVVESGMR KAREKAAKNLADIHKIMGF
References
External Links
ResourceLink
Saccharomyces Genome Database MSW1
Uniprot IDP04803
Uniprot NameSYWM_YEAST
GenBank Gene IDU51030
Genebank Protein ID1230641
General Reference
  • Myers, A. M., Tzagoloff, A. (1985). "MSW, a yeast gene coding for mitochondrial tryptophanyl-tRNA synthetase." J Biol Chem 260:15371-15377.2999114
  • Entrup, R., Langgut, W., Lisowsky, T., Schweizer, E. (1992). "An yeast nuclear mutation conferring temperature-sensitivity to the mitochondrial tryptophanyl-tRNA synthetase." Curr Genet 21:281-283.1525855
  • Jacq, C., Alt-Morbe, J., Andre, B., Arnold, W., Bahr, A., Ballesta, J. P., Bargues, M., Baron, L., Becker, A., Biteau, N., Blocker, H., Blugeon, C., Boskovic, J., Brandt, P., Bruckner, M., Buitrago, M. J., Coster, F., Delaveau, T., del Rey, F., Dujon, B., Eide, L. G., Garcia-Cantalejo, J. M., Goffeau, A., Gomez-Peris, A., Zaccaria, P., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome IV." Nature 387:75-78.9169867
  • Huh, W. K., Falvo, J. V., Gerke, L. C., Carroll, A. S., Howson, R. W., Weissman, J. S., O'Shea, E. K. (2003). "Global analysis of protein localization in budding yeast." Nature 425:686-691.14562095
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Sickmann, A., Reinders, J., Wagner, Y., Joppich, C., Zahedi, R., Meyer, H. E., Schonfisch, B., Perschil, I., Chacinska, A., Guiard, B., Rehling, P., Pfanner, N., Meisinger, C. (2003). "The proteome of Saccharomyces cerevisiae mitochondria." Proc Natl Acad Sci U S A 100:13207-13212.14576278
  • Reinders, J., Zahedi, R. P., Pfanner, N., Meisinger, C., Sickmann, A. (2006). "Toward the complete yeast mitochondrial proteome: multidimensional separation techniques for mitochondrial proteomics." J Proteome Res 5:1543-1554.16823961