You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameThreonyl-tRNA synthetase, cytoplasmic
Synonyms
  • Threonine--tRNA ligase
  • ThrRS
Gene NameTHS1
Enzyme Class
Biological Properties
General FunctionInvolved in nucleotide binding
Specific FunctionATP + L-threonine + tRNA(Thr) = AMP + diphosphate + L-threonyl-tRNA(Thr)
Cellular LocationCytoplasm
SMPDB PathwaysNot Available
KEGG PathwaysNot Available
SMPDB ReactionsNot Available
KEGG Reactions
Adenosine triphosphate + L-Threonine + tRNA(Thr) → Adenosine monophosphate + Pyrophosphate + Thr-tRNA(Thr)
Metabolites
YMDB IDNameView
YMDB00097Adenosine monophosphateShow
YMDB00109Adenosine triphosphateShow
YMDB00214L-ThreonineShow
YMDB00219PyrophosphateShow
GO Classification
Component
cell part
intracellular part
cytoplasm
Function
ligase activity
binding
nucleoside binding
purine nucleoside binding
adenyl nucleotide binding
threonine-tRNA ligase activity
adenyl ribonucleotide binding
ATP binding
ligase activity, forming carbon-oxygen bonds
ligase activity, forming aminoacyl-tRNA and related compounds
aminoacyl-tRNA ligase activity
catalytic activity
nucleotide binding
Process
cellular macromolecule metabolic process
macromolecule metabolic process
RNA metabolic process
ncRNA metabolic process
tRNA metabolic process
biosynthetic process
tRNA aminoacylation
tRNA aminoacylation for protein translation
macromolecule biosynthetic process
cellular macromolecule biosynthetic process
translation
threonyl-tRNA aminoacylation
metabolic process
Gene Properties
Chromosome Locationchromosome 9
LocusYIL078W
Gene Sequence>2205 bp ATGAGTGCTAGTGAAGCAGGTGTCGCTGAGCAAGTCAAAAAGCTGTCTGTCAACGATAGT AGTAATGATGCCGTAAAACCAAATAAGAAAGAAAACAAAAAATCCAAGCAACAGTCCTTG TACTTGGATCCTGAACCAACTTTCATCGAGGAAAGAATTGAAATGTTTGACAGATTACAA AAGGAATACAATGATAAAGTTGCTTCTATGCCACGTGTTCCATTGAAGATTGTCTTGAAG GATGGAGCCGTTAAGGAAGCCACTTCTTGGGAAACCACTCCGATGGATATTGCCAAAGGA ATTTCTAAATCTTTAGCAGACAGGTTATGTATTTCTAAGGTTAATGGTCAATTATGGGAC TTAGATAGACCATTTGAAGGCGAAGCCAACGAAGAAATCAAATTAGAACTGCTAGATTTC GAATCTGACGAAGGTAAGAAGGTCTTTTGGCATTCGTCTGCCCACGTCTTGGGTGAATCT TGTGAGTGCCACCTAGGTGCCCATATTTGTTTAGGTCCTCCAACTGATGATGGGTTCTTT TATGAAATGGCTGTTAGAGATAGTATGAAAGATATATCTGAATCTCCAGAAAGAACCGTC TCCCAAGCTGATTTCCCAGGATTAGAAGGCGTTGCCAAGAATGTTATCAAGCAAAAGCAA AAATTTGAAAGATTGGTCATGTCCAAAGAAGATCTTTTGAAAATGTTTCATTATTCGAAG TATAAGACTTACTTGGTACAGACAAAGGTTCCAGATGGAGGTGCTACTACCGTCTACCGT TGCGGTAAATTGATTGATCTTTGTGTCGGCCCTCATATCCCACATACTGGGCGTATCAAA GCTTTCAAACTATTAAAGAACTCTTCTTGTTATTTCTTAGGTGATGCGACAAACGACTCT TTACAAAGAGTTTACGGTATCTCTTTTCCAGACAAAAAATTAATGGATGCTCATTTGAAG TTCTTGGCGGAAGCCTCTATGAGAGATCACAGAAAGATTGGTAAAGAACAAGAATTATTC TTATTCAATGAAATGTCCCCAGGTTCTTGCTTTTGGTTACCTCATGGTACTAGAATTTAC AACACTTTGGTTGACTTGTTGAGAACTGAATACCGTAAGAGAGGTTACGAAGAAGTCATC ACTCCAAACATGTACAACTCCAAATTGTGGGAAACCTCAGGTCACTGGGCCAATTACAAG GAAAACATGTTTACTTTCGAAGTAGAGAAGGAAACTTTCGGTCTAAAACCAATGAACTGT CCAGGTCATTGTTTGATGTTCAAGTCTAGAGAACGTTCTTATAGAGAATTGCCATGGAGA GTTGCAGACTTCGGTGTTATCCACAGAAATGAATTTTCTGGTGCCTTGTCTGGTTTGACT CGTGTCAGAAGATTCCAACAAGATGATGCTCATATCTTCTGTACCCATGACCAAATTGAA TCTGAAATTGAAAACATTTTCAACTTTTTGCAATACATTTACGGCGTTTTTGGATTTGAA TTTGAAATGGAATTGTCCACTAGACCAGAAAAGTACGTTGGAAAGATCGAAACCTGGGAT GCCGCTGAATCAAAATTAGAATCTGCCTTAAAGAAATGGGGTGGTAACTGGGAGATCAAT GCTGGTGATGGTGCTTTCTACGGTCCAAAGATTGACATTATGATTTCTGACGCTTTAAGA AGATGGCATCAATGTGCCACCATCCAATTAGATTTCCAATTGCCAAACAGGTTCGAATTG GAATTTAAATCTAAAGATCAAGATAGCGAGAGTTACGAAAGACCGGTCATGATCCATCGT GCCATTTTAGGGTCTGTTGAAAGAATGACTGCCATTTTGACCGAGCATTTTGCTGGTAAA TGGCCATTTTGGTTATCACCACGTCAAGTTTTGGTTGTACCAGTTGGTGTCAAGTACCAA GGGTATGCTGAAGACGTCCGTAACAAATTGCACGATGCTGGCTTCTATGCCGATGTCGAT TTGACTGGTAACACTCTGCAAAAGAAGGTCAGAAACGGGCAAATGCTAAAATATAACTTC ATTTTTATTGTTGGTGAACAAGAAATGAATGAAAAATCTGTTAACATTAGAAACAGAGAC GTTATGGAACAACAGGGTAAAAATGCTACTGTTTCTGTTGAAGAGGTTTTGAAACAGTTG CGTAACTTGAAAGATGAAAAGAGAGGTGACAACGTCTTAGCTTAA
Protein Properties
Pfam Domain Function
Protein Residues734
Protein Molecular Weight84519.79688
Protein Theoretical pI7.03
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Threonyl-tRNA synthetase, cytoplasmic MSASEAGVTEQVKKLSVKDSSNDAVKPNKKENKKSKQQSLYLDPEPTFIEERIEMFDRLQ KEYNDKVASMPRVPLKIVLKDGAVKEATSWETTPMDIAKGISKSLADRLCISKVNGQLWD LDRPFEGEANEEIKLELLDFESDEGKKVFWHSSAHVLGESCECHLGAHICLGPPTDDGFF YEMAVRDSMKDISESPERTVSQADFPGLEGVAKNVIKQKQKFERLVMSKEDLLKMFHYSK YKTYLVQTKVPDGGATTVYRCGKLIDLCVGPHIPHTGRIKAFKLLKNSSCYFLGDATNDS LQRVYGISFPDKKLMDAHLKFLAEASMRDHRKIGKEQELFLFNEMSPGSCFWLPHGTRIY NTLVDLLRTEYRKRGYEEVITPNMYNSKLWETSGHWANYKENMFTFEVEKETFGLKPMNC PGHCLMFKSRERSYRELPWRVADFGVIHRNEFSGALSGLTRVRRFQQDDAHIFCTHDQIE SEIENIFNFLQYIYGVFGFEFKMELSTRPEKYVGKIETWDAAESKLESALKKWGGNWEIN AGDGAFYGPKIDIMISDALRRWHQCATIQLDFQLPNRFELEFKSKDQDSESYERPVMIHR AILGSVERMTAILTEHFAGKWPFWLSPRQVLVVPVGVKYQGYAEDVRNKLHDAGFYADVD LTGNTLQKKVRNGQMLKYNFIFIVGEQEMNEKSVNIRNRDVMEQQGKNATVSVEEVLKQL RNLKDEKRGDNVLA
References
External Links
ResourceLink
Saccharomyces Genome Database THS1
Uniprot IDP04801
Uniprot NameSYTC_YEAST
GenBank Gene IDX02906
Genebank Protein ID4619
General Reference
  • Pape, L. K., Tzagoloff, A. (1985). "Cloning and characterization of the gene for the yeast cytoplasmic threonyl-tRNA synthetase." Nucleic Acids Res 13:6171-6183.2995918
  • Churcher, C., Bowman, S., Badcock, K., Bankier, A., Brown, D., Chillingworth, T., Connor, R., Devlin, K., Gentles, S., Hamlin, N., Harris, D., Horsnell, T., Hunt, S., Jagels, K., Jones, M., Lye, G., Moule, S., Odell, C., Pearson, D., Rajandream, M., Rice, P., Rowley, N., Skelton, J., Smith, V., Barrell, B., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome IX." Nature 387:84-87.9169870
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Albuquerque, C. P., Smolka, M. B., Payne, S. H., Bafna, V., Eng, J., Zhou, H. (2008). "A multidimensional chromatography technology for in-depth phosphoproteome analysis." Mol Cell Proteomics 7:1389-1396.18407956