You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameBifunctional protein GAL10
Synonyms
  • UDP-glucose 4-epimerase
  • Galactowaldenase
  • Aldose 1-epimerase
  • Galactose mutarotase
Gene NameGAL10
Enzyme Class
Biological Properties
General FunctionInvolved in isomerase activity
Specific FunctionMutarotase converts alpha-aldose to the beta-anomer. It is active on D-glucose, L-arabinose, D-xylose, D-galactose, maltose and lactose
Cellular LocationNot Available
SMPDB Pathways
Amino sugar and nucleotide sugar metabolismPW002413 ThumbThumb?image type=greyscaleThumb?image type=simple
Ethanol fermentationPW002448 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Amino sugar and nucleotide sugar metabolismec00520 Map00520
Glycolysis / Gluconeogenesisec00010 Map00010
SMPDB Reactions
Beta-D-GalactoseD-Galactose
UDP-D-galactoseUridine diphosphate glucose
Uridine diphosphate glucoseUDP-D-galactose
KEGG Reactions
Uridine diphosphate glucoseUDP-D-galactose
Metabolites
YMDB IDNameView
YMDB00072D-GalactoseShow
YMDB00146Beta-D-GlucoseShow
YMDB00212Uridine diphosphate glucoseShow
YMDB00273Alpha-D-GlucoseShow
YMDB00415UDP-D-glucoseShow
YMDB00692UDP-D-galactoseShow
YMDB00797udp-galactoseShow
YMDB16159Beta-D-GalactoseShow
GO Classification
Component
Not Available
Function
coenzyme binding
isomerase activity
catalytic activity
racemase and epimerase activity
racemase and epimerase activity, acting on carbohydrates and derivatives
UDP-glucose 4-epimerase activity
binding
carbohydrate binding
cofactor binding
Process
metabolic process
cellular metabolic process
primary metabolic process
carbohydrate metabolic process
small molecule metabolic process
alcohol metabolic process
monosaccharide metabolic process
hexose metabolic process
galactose metabolic process
Gene Properties
Chromosome Locationchromosome 2
LocusYBR019C
Gene Sequence>2100 bp ATGACAGCTCAGTTACAAAGTGAAAGTACTTCTAAAATTGTTTTGGTTACAGGTGGTGCT GGATACATTGGTTCACACACTGTGGTAGAGCTAATTGAGAATGGATATGACTGTGTTGTT GCTGATAACCTGTCGAATTCAACTTATGATTCTGTAGCCAGGTTAGAGGTCTTGACCAAG CATCACATTCCCTTCTATGAGGTTGATTTGTGTGACCGAAAAGGTCTGGAAAAGGTTTTC AAAGAATATAAAATTGATTCGGTAATTCACTTTGCTGGTTTAAAGGCTGTAGGTGAATCT ACACAAATCCCGCTGAGATACTATCACAATAACATTTTGGGAACTGTCGTTTTATTAGAG TTAATGCAACAATACAACGTTTCCAAATTTGTTTTTTCATCTTCTGCTACTGTCTATGGT GATGCTACGAGATTCCCAAATATGATTCCTATCCCAGAAGAATGTCCCTTAGGGCCTACT AATCCGTATGGTCATACGAAATACGCCATTGAGAATATCTTGAATGATCTTTACAATAGC GACAAAAAAAGTTGGAAGTTTGCTATCTTGCGTTATTTTAACCCAATTGGCGCACATCCC TCTGGATTAATCGGAGAAGATCCGCTAGGTATACCAAACAATTTGTTGCCATATATGGCT CAAGTAGCTGTTGGTAGGCGCGAGAAGCTTTACATCTTCGGAGACGATTATGATTCCAGA GATGGTACCCCGATCAGGGATTATATCCACGTAGTTGATCTAGCAAAAGGTCATATTGCA GCCCTGCAATACCTAGAGGCCTACAATGAAAATGAAGGTTTGTGTCGTGAGTGGAACTTG GGTTCCGGTAAAGGTTCTACAGTTTTTGAAGTTTATCATGCATTCTGCAAAGCTTCTGGT ATTGATCTTCCATACAAAGTTACGGGCAGAAGAGCAGGTGATGTTTTGAACTTGACGGCT AAACCAGATAGGGCCAAACGCGAACTGAAATGGCAGACCGAGTTGCAGGTTGAAGACTCC TGCAAGGATTTATGGAAATGGACTACTGAGAATCCTTTTGGTTACCAGTTAAGGGGTGTC GAGGCCAGATTTTCCGCTGAAGATATGCGTTATGACGCAAGATTTGTGACTATTGGTGCC GGCACCAGATTTCAAGCCACGTTTGCCAATTTGGGCGCCAGCATTGTTGACCTGAAAGTG AACGGACAATCAGTTGTTCTTGGCTATGAAAATGAGGAAGGGTATTTGAATCCTGATAGT GCTTATATAGGCGCCACGATCGGCAGGTATGCTAATCGTATTTCGAAGGGTAAGTTTAGT TTATGCAACAAAGACTATCAGTTAACCGTTAATAACGGCGTTAATGCGAATCATAGTAGT ATCGGTTCTTTCCACAGAAAAAGATTTTTGGGACCCATCATTCAAAATCCTTCAAAGGAT GTTTTTACCGCCGAGTACATGCTGATAGATAATGAGAAGGACACCGAATTTCCAGGTGAT CTATTGGTAACCATACAGTATACTGTGAACGTTGCCCAAAAAAGTTTGGAAATGGTATAT AAAGGTAAATTGACTGCTGGTGAAGCGACGCCAATAAATTTAACAAATCATAGTTATTTC AATCTGAACAAGCCATATGGAGACACTATTGAGGGTACGGAGATTATGGTGCGTTCAAAA AAATCTGTTGATGTCGACAAAAACATGATTCCTACGGGTAATATCGTCGATAGAGAAATT GCTACCTTTAACTCTACAAAGCCAACGGTCTTAGGCCCCAAAAATCCCCAGTTTGATTGT TGTTTTGTGGTGGATGAAAATGCTAAGCCAAGTCAAATCAATACTCTAAACAATGAATTG ACGCTTATTGTCAAGGCTTTTCATCCCGATTCCAATATTACATTAGAAGTTTTAAGTACA GAGCCAACTTATCAATTTTATACCGGTGATTTCTTGTCTGCTGGTTACGAAGCAAGACAA GGTTTTGCAATTGAGCCTGGTAGATACATTGATGCTATCAATCAAGAGAACTGGAAAGAT TGTGTAACCTTGAAAAACGGTGAAACTTACGGGTCCAAGATTGTCTACAGATTTTCCTGA
Protein Properties
Pfam Domain Function
Protein Residues699
Protein Molecular Weight78194.70313
Protein Theoretical pI5.8
PDB Fileshow
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Bifunctional protein GAL10 MTAQLQSESTSKIVLVTGGAGYIGSHTVVELIENGYDCVVADNLSNSTYDSVARLEVLTK HHIPFYEVDLCDRKGLEKVFKEYKIDSVIHFAGLKAVGESTQIPLRYYHNNILGTVVLLE LMQQYNVSKFVFSSSATVYGDATRFPNMIPIPEECPLGPTNPYGHTKYAIENILNDLYNS DKKSWKFAILRYFNPIGAHPSGLIGEDPLGIPNNLLPYMAQVAVGRREKLYIFGDDYDSR DGTPIRDYIHVVDLAKGHIAALQYLEAYNENEGLCREWNLGSGKGSTVFEVYHAFCKASG IDLPYKVTGRRAGDVLNLTAKPDRAKRELKWQTELQVEDSCKDLWKWTTENPFGYQLRGV EARFSAEDMRYDARFVTIGAGTRFQATFANLGASIVDLKVNGQSVVLGYENEEGYLNPDS AYIGATIGRYANRISKGKFSLCNKDYQLTVNNGVNANHSSIGSFHRKRFLGPIIQNPSKD VFTAEYMLIDNEKDTEFPGDLLVTIQYTVNVAQKSLEMVYKGKLTAGEATPINLTNHSYF NLNKPYGDTIEGTEIMVRSKKSVDVDKNMIPTGNIVDREIATFNSTKPTVLGPKNPQFDC CFVVDENAKPSQINTLNNELTLIVKAFHPDSNITLEVLSTEPTYQFYTGDFLSAGYEARQ GFAIEPGRYIDAINQENWKDCVTLKNGETYGSKIVYRFS
References
External Links
ResourceLink
Saccharomyces Genome Database GAL10
Uniprot IDP04397
Uniprot NameGAL10_YEAST
GenBank Gene IDZ35888
Genebank Protein ID536222
PDB ID
1Z45
General Reference
  • Feldmann, H., Aigle, M., Aljinovic, G., Andre, B., Baclet, M. C., Barthe, C., Baur, A., Becam, A. M., Biteau, N., Boles, E., Brandt, T., Brendel, M., Bruckner, M., Bussereau, F., Christiansen, C., Contreras, R., Crouzet, M., Cziepluch, C., Demolis, N., Delaveau, T., Doignon, F., Domdey, H., Dusterhus, S., Dubois, E., Dujon, B., El Bakkoury, M., Entian, K. D., Feurmann, M., Fiers, W., Fobo, G. M., Fritz, C., Gassenhuber, H., Glandsdorff, N., Goffeau, A., Grivell, L. A., de Haan, M., Hein, C., Herbert, C. J., Hollenberg, C. P., Holmstrom, K., Jacq, C., Jacquet, M., Jauniaux, J. C., Jonniaux, J. L., Kallesoe, T., Kiesau, P., Kirchrath, L., Kotter, P., Korol, S., Liebl, S., Logghe, M., Lohan, A. J., Louis, E. J., Li, Z. Y., Maat, M. J., Mallet, L., Mannhaupt, G., Messenguy, F., Miosga, T., Molemans, F., Muller, S., Nasr, F., Obermaier, B., Perea, J., Pierard, A., Piravandi, E., Pohl, F. M., Pohl, T. M., Potier, S., Proft, M., Purnelle, B., Ramezani Rad, M., Rieger, M., Rose, M., Schaaff-Gerstenschlager, I., Scherens, B., Schwarzlose, C., Skala, J., Slonimski, P. P., Smits, P. H., Souciet, J. L., Steensma, H. Y., Stucka, R., Urrestarazu, A., van der Aart, Q. J., van Dyck, L., Vassarotti, A., Vetter, I., Vierendeels, F., Vissers, S., Wagner, G., de Wergifosse, P., Wolfe, K. H., Zagulski, M., Zimmermann, F. K., Mewes, H. W., Kleine, K. (1994). "Complete DNA sequence of yeast chromosome II." EMBO J 13:5795-5809.7813418
  • Smits, P. H., De Haan, M., Maat, C., Grivell, L. A. (1994). "The complete sequence of a 33 kb fragment on the right arm of chromosome II from Saccharomyces cerevisiae reveals 16 open reading frames, including ten new open reading frames, five previously identified genes and a homologue of the SCO1 gene." Yeast 10 Suppl A:S75-S80.8091864
  • Schaaff-Gerstenschlager, I., Schindwolf, T., Lehnert, W., Rose, M., Zimmermann, F. K. (1995). "Sequence and functional analysis of a 7.2 kb fragment of Saccharomyces cerevisiae chromosome II including GAL7 and GAL10 and a new essential open reading frame." Yeast 11:79-83.7762304
  • Citron, B. A., Donelson, J. E. (1984). "Sequence of the Saccharomyces GAL region and its transcription in vivo." J Bacteriol 158:269-278.6715281
  • Johnston, M., Davis, R. W. (1984). "Sequences that regulate the divergent GAL1-GAL10 promoter in Saccharomyces cerevisiae." Mol Cell Biol 4:1440-1448.6092912
  • Tajima, M., Nogi, Y., Fukasawa, T. (1985). "Primary structure of the Saccharomyces cerevisiae GAL7 gene." Yeast 1:67-77.2851900