You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NamePhosphoribosylglycinamide formyltransferase
Synonyms
  • 5'-phosphoribosylglycinamide transformylase
  • GAR transformylase
  • GART
Gene NameADE8
Enzyme Class
Biological Properties
General FunctionInvolved in hydroxymethyl-, formyl- and related transferase activity
Specific Function10-formyltetrahydrofolate + N(1)-(5-phospho-D- ribosyl)glycinamide = tetrahydrofolate + N(2)-formyl-N(1)-(5- phospho-D-ribosyl)glycinamide
Cellular LocationNot Available
SMPDB Pathways
tetrahydrofolate biosynthesisPW002417 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
One carbon pool by folateec00670 Map00670
Purine metabolismec00230 Map00230
SMPDB Reactions
N10-Formyl-THF + 5'-Phosphoribosyl-N-formylglycinamideTetrahydrofolic acid + 5'-Phosphoribosyl-N-formylglycinamide
KEGG Reactions
N10-Formyl-THF + Glycineamideribotide5,6,7,8-Tetrahydrofolic acid + hydron + 5'-Phosphoribosyl-N-formylglycinamide
Metabolites
YMDB IDNameView
YMDB000015'-Phosphoribosyl-N-formylglycinamideShow
YMDB00080N10-Formyl-THFShow
YMDB00139Tetrahydrofolic acidShow
YMDB00374GlycineamideribotideShow
YMDB004835,6,7,8-Tetrahydrofolic acidShow
YMDB0051710-Formyltetrahydrofolic acidShow
YMDB00759N(2)-formyl-N(1)-(5-phospho-D-ribosyl)glycinamideShow
YMDB00760N(1)-(5-phospho-D-ribosyl)glycinamideShow
YMDB00862hydronShow
GO Classification
Component
Not Available
Function
transferase activity
transferase activity, transferring one-carbon groups
methyltransferase activity
glycine hydroxymethyltransferase activity
hydroxymethyl-, formyl- and related transferase activity
catalytic activity
phosphoribosylglycinamide formyltransferase activity
Process
metabolic process
nitrogen compound metabolic process
cellular nitrogen compound metabolic process
biosynthetic process
nucleobase, nucleoside, nucleotide and nucleic acid metabolic process
nucleobase, nucleoside and nucleotide metabolic process
nucleoside phosphate metabolic process
nucleotide metabolic process
purine nucleotide metabolic process
purine nucleotide biosynthetic process
purine nucleoside monophosphate biosynthetic process
purine ribonucleoside monophosphate biosynthetic process
IMP biosynthetic process
'de novo' IMP biosynthetic process
Gene Properties
Chromosome Locationchromosome 4
LocusYDR408C
Gene Sequence>645 bp ATGGCCAGAATTGTCGTATTAATTTCGGGCTCAGGTTCCAACTTGCAAGCCTTGATCGAT GCCCAAAAGCAGGGCCAATTAGGCGAGGATGCTCATATTGTCTCTGTCATATCTTCCAGC AAGAAGGCATACGGGTTAACTAGGGCAGCGGACAATAATATCCCCACAAAGGTTTGTTCG CTATACCCATATACAAAGGGTATTGCGAAGGAGGACAAAGCCGCAAGGGCCAAGGCAAGA TCCCAGTTTGAGAACGACCTCGCAAAACTAGTGCTCGAGGAAAAGCCTGACGTTATCATC TGCGCGGGCTGGTTATTGATCCTTGGATCTACTTTCTTGAGCCAACTGCAATCTGTGCCG ATATTAAATCTGCATCCAGCGCTACCAGGTTGTTTCGATGGTACCACACACGCAATTGAA ATGGCATGGCGCAAATGTCAGGACGAGAACAAGCCTCTGACGGCCGGATGCATGGTGCAC TATGTCATCGAGGAGGTCGACAAGGGTGAGCCATTGGTGGTAAAAAAGCTAGAAATCATA CCTGGCGAAGAAACACTAGAGCAGTACGAGCAAAGGGTACACGATGCTGAGCACATCGCG ATTGTAGAAGCTACATATAAGGTTTTACAGCAGCTTCACAAATAA
Protein Properties
Pfam Domain Function
Protein Residues214
Protein Molecular Weight23540.0
Protein Theoretical pI6.39
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Phosphoribosylglycinamide formyltransferase MARIVVLISGSGSNLQALIDAQKQGQLGEDAHIVSVISSSKKAYGLTRAADNNIPTKVCS LYPYTKGIAKEDKAARAKARSQFENDLAKLVLEEKPDVIICAGWLLILGSTFLSQLQSVP ILNLHPALPGCFDGTTHAIEMAWRKCQDENKPLTAGCMVHYVIEEVDKGEPLVVKKLEII PGEETLEQYEQRVHDAEHIAIVEATYKVLQQLHK
References
External Links
ResourceLink
Saccharomyces Genome Database ADE8
Uniprot IDP04161
Uniprot NamePUR3_YEAST
GenBank Gene IDM36585
Genebank Protein ID171015
General Reference
  • White, J. H., Lusnak, K., Fogel, S. (1985). "Mismatch-specific post-meiotic segregation frequency in yeast suggests a heteroduplex recombination intermediate." Nature 315:350-352.3889658
  • Jacq, C., Alt-Morbe, J., Andre, B., Arnold, W., Bahr, A., Ballesta, J. P., Bargues, M., Baron, L., Becker, A., Biteau, N., Blocker, H., Blugeon, C., Boskovic, J., Brandt, P., Bruckner, M., Buitrago, M. J., Coster, F., Delaveau, T., del Rey, F., Dujon, B., Eide, L. G., Garcia-Cantalejo, J. M., Goffeau, A., Gomez-Peris, A., Zaccaria, P., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome IV." Nature 387:75-78.9169867
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106