You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameCytochrome c oxidase polypeptide VIII, mitochondrial
SynonymsNot Available
Gene NameCOX8
Enzyme Class
Biological Properties
General FunctionInvolved in cytochrome-c oxidase activity
Specific Function4 ferrocytochrome c + O(2) + 4 H(+) = 4 ferricytochrome c + 2 H(2)O
Cellular LocationMitochondrion inner membrane
SMPDB Pathways
Oxidative phosphorylationPW002461 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Oxidative phosphorylationec00190 Map00190
SMPDB ReactionsNot Available
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB00862hydronShow
GO Classification
Component
Not Available
Function
catalytic activity
oxidoreductase activity
heme-copper terminal oxidase activity
cytochrome-c oxidase activity
Process
Not Available
Gene Properties
Chromosome Locationchromosome 12
LocusYLR395C
Gene Sequence>237 bp ATGTTGTGCCAACAGATGATTAGAACGACAGCTAAGAGAAGTAGCAATATCATGACCAGA CCTATTATCATGAAGAGGTCAGTACACTTCAAAGACGGTGTGTATGAAAATATCCCATTC AAAGTCAAAGGAAGAAAGACACCTTACGCCTTATCTCATTTCGGGTTCTTCGCTATTGGA TTTGCTGTTCCATTTGTTGCCTGCTATGTTCAATTGAAAAAGTCAGGTGCTTTTTAA
Protein Properties
Pfam Domain Function
Protein Residues78
Protein Molecular Weight8906.59961
Protein Theoretical pI11.05
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Cytochrome c oxidase polypeptide VIII, mitochondrial MLCQQMIRTTAKRSSNIMTRPIIMKRSVHFKDGVYENIPFKVKGRKTPYALSHFGFFAIG FAVPFVACYVQLKKSGAF
References
External Links
ResourceLink
Saccharomyces Genome Database COX8
Uniprot IDP04039
Uniprot NameCOX8_YEAST
GenBank Gene IDAY558228
Genebank Protein ID45270346
General Reference
  • Patterson, T. E., Poyton, R. O. (1986). "COX8, the structural gene for yeast cytochrome c oxidase subunit VIII. DNA sequence and gene disruption indicate that subunit VIII is required for maximal levels of cellular respiration and is derived from a precursor which is extended at both its NH2 and COOH termini." J Biol Chem 261:17192-17197.3023386
  • Johnston, M., Hillier, L., Riles, L., Albermann, K., Andre, B., Ansorge, W., Benes, V., Bruckner, M., Delius, H., Dubois, E., Dusterhoft, A., Entian, K. D., Floeth, M., Goffeau, A., Hebling, U., Heumann, K., Heuss-Neitzel, D., Hilbert, H., Hilger, F., Kleine, K., Kotter, P., Louis, E. J., Messenguy, F., Mewes, H. W., Hoheisel, J. D., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome XII." Nature 387:87-90.9169871
  • Hu, Y., Rolfs, A., Bhullar, B., Murthy, T. V., Zhu, C., Berger, M. F., Camargo, A. A., Kelley, F., McCarron, S., Jepson, D., Richardson, A., Raphael, J., Moreira, D., Taycher, E., Zuo, D., Mohr, S., Kane, M. F., Williamson, J., Simpson, A., Bulyk, M. L., Harlow, E., Marsischky, G., Kolodner, R. D., LaBaer, J. (2007). "Approaching a complete repository of sequence-verified protein-encoding clones for Saccharomyces cerevisiae." Genome Res 17:536-543.17322287
  • Power, S. D., Lochrie, M. A., Patterson, T. E., Poyton, R. O. (1984). "The nuclear-coded subunits of yeast cytochrome c oxidase. II. The amino acid sequence of subunit VIII and a model for its disposition in the inner mitochondrial membrane." J Biol Chem 259:6571-6574.6327685
  • Geier, B. M., Schagger, H., Ortwein, C., Link, T. A., Hagen, W. R., Brandt, U., Von Jagow, G. (1995). "Kinetic properties and ligand binding of the eleven-subunit cytochrome-c oxidase from Saccharomyces cerevisiae isolated with a novel large-scale purification method." Eur J Biochem 227:296-302.7851399
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106