You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameCytochrome c oxidase subunit 4, mitochondrial
Synonyms
  • Cytochrome c oxidase polypeptide IV
Gene NameCOX4
Enzyme ClassNot Available
Biological Properties
General FunctionInvolved in cytochrome-c oxidase activity
Specific FunctionNot Available
Cellular LocationMitochondrion inner membrane
SMPDB PathwaysNot Available
KEGG PathwaysNot Available
SMPDB ReactionsNot Available
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
GO Classification
Component
cell part
envelope
organelle envelope
mitochondrial envelope
Function
catalytic activity
oxidoreductase activity
heme-copper terminal oxidase activity
cytochrome-c oxidase activity
Gene Properties
Chromosome LocationNot Available
Locus
Gene Sequence>468 bp ATGCTTTCACTACGTCAATCTATAAGATTTTTCAAGCCAGCCACAAGAACTTTGTGTAGC TCTAGATATCTGCTTCAGCAAAAACCCGTGGTGAAAACTGCCCAAAACTTAGCAGAAGTT AATGGTCCAGAAACTTTGATTGGTCCTGGTGCTAAAGAGGGTACCGTTCCAACAGACCTA GATCAAGAAACTGGTTTAGCTAGGTTAGAATTATTGGGTAAATTAGAGGGTATCGATGTT TTCGACACCAAACCATTAGATTCGTCCAGGAAGGGTACCATGAAAGATCCGATCATCATT GAATCTTATGATGATTATCGTTATGTCGGTTGTACGGGTTCTCCCGCTGGTTCACATACT ATTATGTGGTTAAAACCAACTGTTAACGAAGTCGCCAGATGCTGGGAATGTGGTTCTGTT TACAAACTAAACCCTGTTGGTGTTCCAAATGATGACCACCATCACTAA
Protein Properties
Pfam Domain Function
Protein Residues155
Protein Molecular Weight17142.40039
Protein Theoretical pI6.92
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Cytochrome c oxidase subunit 4, mitochondrial MLSLRQSIRFFKPATRTLCSSRYLLQQKPVVKTAQNLAEVNGPETLIGPGAKEGTVPTDL DQETGLARLELLGKLEGIDVFDTKPLDSSRKGTMKDPIIIESYDDYRYVGCTGSPAGSHT IMWLKPTVNEVARCWECGSVYKLNPVGVPNDDHHH
References
External Links
ResourceLink
Saccharomyces Genome Database COX4
Uniprot IDP04037
Uniprot NameCOX4_YEAST
GenBank Gene IDX01418
Genebank Protein ID3582
General Reference
  • Maarse, A. C., Van Loon, A. P., Riezman, H., Gregor, I., Schatz, G., Grivell, L. A. (1984). "Subunit IV of yeast cytochrome c oxidase: cloning and nucleotide sequencing of the gene and partial amino acid sequencing of the mature protein." EMBO J 3:2831-2837.6098449
  • Coglievina, M., Klima, R., Bertani, I., Delneri, D., Zaccaria, P., Bruschi, C. V. (1997). "Sequencing of a 40.5 kb fragment located on the left arm of chromosome VII from Saccharomyces cerevisiae." Yeast 13:55-64.9046087
  • Tettelin, H., Agostoni Carbone, M. L., Albermann, K., Albers, M., Arroyo, J., Backes, U., Barreiros, T., Bertani, I., Bjourson, A. J., Bruckner, M., Bruschi, C. V., Carignani, G., Castagnoli, L., Cerdan, E., Clemente, M. L., Coblenz, A., Coglievina, M., Coissac, E., Defoor, E., Del Bino, S., Delius, H., Delneri, D., de Wergifosse, P., Dujon, B., Kleine, K., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome VII." Nature 387:81-84.9169869
  • Juneau, K., Palm, C., Miranda, M., Davis, R. W. (2007). "High-density yeast-tiling array reveals previously undiscovered introns and extensive regulation of meiotic splicing." Proc Natl Acad Sci U S A 104:1522-1527.17244705
  • Schneider, J. C., Guarente, L. (1987). "The untranslated leader of nuclear COX4 gene of Saccharomyces cerevisiae contains an intron." Nucleic Acids Res 15:3515-3529.3033605
  • Power, S. D., Lochrie, M. A., Poyton, R. O. (1984). "The nuclear-coded subunits of yeast cytochrome c oxidase. III. Identification of homologous subunits in yeast, bovine heart, and Neurospora crassa cytochrome c oxidases." J Biol Chem 259:6575-6578.6327686
  • Geier, B. M., Schagger, H., Ortwein, C., Link, T. A., Hagen, W. R., Brandt, U., Von Jagow, G. (1995). "Kinetic properties and ligand binding of the eleven-subunit cytochrome-c oxidase from Saccharomyces cerevisiae isolated with a novel large-scale purification method." Eur J Biochem 227:296-302.7851399
  • Reinders, J., Wagner, K., Zahedi, R. P., Stojanovski, D., Eyrich, B., van der Laan, M., Rehling, P., Sickmann, A., Pfanner, N., Meisinger, C. (2007). "Profiling phosphoproteins of yeast mitochondria reveals a role of phosphorylation in assembly of the ATP synthase." Mol Cell Proteomics 6:1896-1906.17761666
  • Taylor, A. B., Smith, B. S., Kitada, S., Kojima, K., Miyaura, H., Otwinowski, Z., Ito, A., Deisenhofer, J. (2001). "Crystal structures of mitochondrial processing peptidase reveal the mode for specific cleavage of import signal sequences." Structure 9:615-625.11470436