You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameOrotidine 5'-phosphate decarboxylase
Synonyms
  • OMP decarboxylase
  • OMPDCase
  • OMPdecase
  • Uridine 5'-monophosphate synthase
  • UMP synthase
Gene NameURA3
Enzyme Class
Biological Properties
General FunctionInvolved in catalytic activity
Specific FunctionOrotidine 5'-phosphate = UMP + CO(2)
Cellular LocationNot Available
SMPDB Pathways
Pyrimidine metabolismPW002469 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Pyrimidine metabolismec00240 Map00240
SMPDB ReactionsNot Available
KEGG Reactions
hydron + Orotidylic acidCarbon dioxide + Uridine 5'-monophosphate
Metabolites
YMDB IDNameView
YMDB00025Orotidylic acidShow
YMDB00049Uridine 5'-monophosphateShow
YMDB00862hydronShow
YMDB00912Carbon dioxideShow
GO Classification
Component
Not Available
Function
orotidine-5'-phosphate decarboxylase activity
lyase activity
carbon-carbon lyase activity
carboxy-lyase activity
catalytic activity
Process
'de novo' pyrimidine base biosynthetic process
metabolic process
pyrimidine nucleotide metabolic process
nitrogen compound metabolic process
pyrimidine nucleotide biosynthetic process
cellular nitrogen compound metabolic process
nucleobase, nucleoside, nucleotide and nucleic acid metabolic process
pyrimidine nucleoside monophosphate biosynthetic process
nucleobase, nucleoside and nucleotide metabolic process
pyrimidine ribonucleoside monophosphate biosynthetic process
nucleoside phosphate metabolic process
UMP biosynthetic process
nucleotide metabolic process
'de novo' UMP biosynthetic process
cellular metabolic process
cellular aromatic compound metabolic process
nucleobase metabolic process
pyrimidine base metabolic process
pyrimidine base biosynthetic process
Gene Properties
Chromosome Locationchromosome 5
LocusYEL021W
Gene Sequence>804 bp ATGTCGAAAGCTACATATAAGGAACGTGCTGCTACTCATCCTAGTCCTGTTGCTGCCAAG CTATTTAATATCATGCACGAAAAGCAAACAAACTTGTGTGCTTCATTGGATGTTCGTACC ACCAAGGAATTACTGGAGTTAGTTGAAGCATTAGGTCCCAAAATTTGTTTACTAAAAACA CATGTGGATATCTTGACTGATTTTTCCATGGAGGGCACAGTTAAGCCGCTAAAGGCATTA TCCGCCAAGTACAATTTTTTACTCTTCGAAGACAGAAAATTTGCTGACATTGGTAATACA GTCAAATTGCAGTACTCTGCGGGTGTATACAGAATAGCAGAATGGGCAGACATTACGAAT GCACACGGTGTGGTGGGCCCAGGTATTGTTAGCGGTTTGAAGCAGGCGGCAGAAGAAGTA ACAAAGGAACCTAGAGGCCTTTTGATGTTAGCAGAATTGTCATGCAAGGGCTCCCTATCT ACTGGAGAATATACTAAGGGTACTGTTGACATTGCGAAGAGCGACAAAGATTTTGTTATC GGCTTTATTGCTCAAAGAGACATGGGTGGAAGAGATGAAGGTTACGATTGGTTGATTATG ACACCCGGTGTGGGTTTAGATGACAAGGGAGACGCATTGGGTCAACAGTATAGAACCGTG GATGATGTGGTCTCTACAGGATCTGACATTATTATTGTTGGAAGAGGACTATTTGCAAAG GGAAGGGATGCTAAGGTAGAGGGTGAACGTTACAGAAAAGCAGGCTGGGAAGCATATTTG AGAAGATGCGGCCAGCAAAACTAA
Protein Properties
Pfam Domain Function
Protein Residues267
Protein Molecular Weight29239.30078
Protein Theoretical pI7.45
PDB Fileshow
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Orotidine 5'-phosphate decarboxylase MSKATYKERAATHPSPVAAKLFNIMHEKQTNLCASLDVRTTKELLELVEALGPKICLLKT HVDILTDFSMEGTVKPLKALSAKYNFLLFEDRKFADIGNTVKLQYSAGVYRIAEWADITN AHGVVGPGIVSGLKQAAEEVTKEPRGLLMLAELSCKGSLATGEYTKGTVDIAKSDKDFVI GFIAQRDMGGRDEGYDWLIMTPGVGLDDKGDALGQQYRTVDDVVSTGSDIIIVGRGLFAK GRDAKVEGERYRKAGWEAYLRRCGQQN
References
External Links
ResourceLink
Saccharomyces Genome Database URA3
Uniprot IDP03962
Uniprot NamePYRF_YEAST
GenBank Gene IDK02206
Genebank Protein ID172060
PDB ID
1DQX
General Reference
  • Rose, M., Grisafi, P., Botstein, D. (1984). "Structure and function of the yeast URA3 gene: expression in Escherichia coli." Gene 29:113-124.6092217
  • Dietrich, F. S., Mulligan, J., Hennessy, K., Yelton, M. A., Allen, E., Araujo, R., Aviles, E., Berno, A., Brennan, T., Carpenter, J., Chen, E., Cherry, J. M., Chung, E., Duncan, M., Guzman, E., Hartzell, G., Hunicke-Smith, S., Hyman, R. W., Kayser, A., Komp, C., Lashkari, D., Lew, H., Lin, D., Mosedale, D., Davis, R. W., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome V." Nature 387:78-81.9169868
  • Yarger, J. G., Armilei, G., Gorman, M. C. (1986). "Transcription terminator-like element within a Saccharomyces cerevisiae promoter region." Mol Cell Biol 6:1095-1101.3023868
  • Rose, M., Botstein, D. (1983). "Structure and function of the yeast URA3 gene. Differentially regulated expression of hybrid beta-galactosidase from overlapping coding sequences in yeast." J Mol Biol 170:883-904.6315953
  • Miller, B. G., Snider, M. J., Wolfenden, R., Short, S. A. (2001). "Dissecting a charged network at the active site of orotidine-5'-phosphate decarboxylase." J Biol Chem 276:15174-15176.11278904
  • Peng, J., Schwartz, D., Elias, J. E., Thoreen, C. C., Cheng, D., Marsischky, G., Roelofs, J., Finley, D., Gygi, S. P. (2003). "A proteomics approach to understanding protein ubiquitination." Nat Biotechnol 21:921-926.12872131
  • Albuquerque, C. P., Smolka, M. B., Payne, S. H., Bafna, V., Eng, J., Zhou, H. (2008). "A multidimensional chromatography technology for in-depth phosphoproteome analysis." Mol Cell Proteomics 7:1389-1396.18407956
  • Miller, B. G., Hassell, A. M., Wolfenden, R., Milburn, M. V., Short, S. A. (2000). "Anatomy of a proficient enzyme: the structure of orotidine 5'-monophosphate decarboxylase in the presence and absence of a potential transition state analog." Proc Natl Acad Sci U S A 97:2011-2016.10681417