You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameMethionyl-tRNA synthetase, cytoplasmic
Synonyms
  • Methionine--tRNA ligase
  • MetRS
Gene NameMES1
Enzyme Class
Biological Properties
General FunctionInvolved in nucleotide binding
Specific FunctionATP + L-methionine + tRNA(Met) = AMP + diphosphate + L-methionyl-tRNA(Met)
Cellular LocationCytoplasm
SMPDB Pathways
Selenocompound metabolismPW002472 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Selenocompound metabolismec00450 Map00450
SMPDB Reactions
Adenosine triphosphate + tRNA(Met) + SelenomethionineAdenosine monophosphate + Pyrophosphate + Selenomethionyl-tRNA(Met)
KEGG Reactions
L-Methionine + tRNA(Met) + Adenosine triphosphateAdenosine monophosphate + Pyrophosphate + Met-tRNA(Met)
Metabolites
YMDB IDNameView
YMDB00097Adenosine monophosphateShow
YMDB00109Adenosine triphosphateShow
YMDB00219PyrophosphateShow
YMDB00318L-MethionineShow
YMDB16175SelenomethionineShow
GO Classification
Component
intracellular part
cytoplasm
cell part
Function
binding
nucleotide binding
nucleoside binding
purine nucleoside binding
catalytic activity
adenyl nucleotide binding
adenyl ribonucleotide binding
ATP binding
ligase activity, forming carbon-oxygen bonds
ligase activity
ligase activity, forming aminoacyl-tRNA and related compounds
aminoacyl-tRNA ligase activity
methionine-tRNA ligase activity
Process
methionyl-tRNA aminoacylation
cellular macromolecule metabolic process
RNA metabolic process
ncRNA metabolic process
tRNA metabolic process
tRNA aminoacylation
metabolic process
tRNA aminoacylation for protein translation
macromolecule metabolic process
macromolecule biosynthetic process
cellular macromolecule biosynthetic process
translation
biosynthetic process
Gene Properties
Chromosome Locationchromosome 7
LocusYGR264C
Gene Sequence>2256 bp ATGTCTTTCCTCATTTCCTTTGATAAATCAAAGAAACATCCTGCCCATTTGCAGTTAGCG AACAATTTGAAGATTGCCCTAGCACTTGAATATGCAAGCAAAAATTTAAAGCCCGAAGTT GACAATGATAATGCTGCCATGGAATTGCGCAATACAAAGGAACCTTTCCTTTTGTTTGAT GCTAACGCTATTCTAAGATATGTCATGGATGATTTTGAAGGTCAAACTTCCGACAAGTAT CAATTTGCATTGGCATCTTTACAAAACCTGTTATATCATAAAGAATTACCTCAACAGCAT GTCGAGGTTTTGACAAATAAGGCCATTGAAAATTACTTGGTCGAATTAAAAGAACCATTG ACTGCTACAGATTTGATCCTGTTTGCTAACGTTTATGCTCTAAATTCTTCTTTAGTTCAT TCTAAATTCCCAGAATTGCCATCCAAAGTGCATAACGCTGTAGCATTGGCTAAAAAGCAT GTTCCACGTGATTCTTCTTCTTTCAAAAACATCGGCGCAGTGAAAATCCAAGCTGACTTA ACAGTTAAGCCAAAGGATTCAGAAATTTTGCCTAAGCCAAACGAAAGAAACATCTTGATC ACTTCGGCATTACCTTATGTCAACAACGTTCCACACTTGGGTAATATCATCGGTAGTGTT CTTTCAGCAGACATTTTTGCTCGTTACTGTAAGGGACGTAATTATAATGCCTTGTTTATT TGTGGTACTGATGAATATGGTACTGCCACGGAAACTAAAGCTTTGGAGGAAGGTGTGACA CCAAGACAACTATGTGACAAATATCACAAAATCCACAGTGACGTTTACAAGTGGTTCCAA ATTGGATTTGATTATTTCGGTAGAACTACGACGGATAAGCAAACGGAGATTGCTCAACAT ATTTTTACAAAGCTAAATTCGAATGGTTATCTAGAAGAACAATCTATGAAGCAATTGTAC TGTCCAGTTCATAATTCTTATCTGGCTGATCGTTACGTGGAAGGTGAATGTCCAAAATGT CACTACGATGATGCTCGTGGGGATCAATGTGACAAATGTGGTGCCCTGTTAGATCCATTT GAATTGATCAATCCACGTTGTAAATTAGATGATGCTTCTCCAGAACCAAAATATTCTGAT CATATTTTCCTATCGCTGGATAAATTAGAAAGCCAAATTTCTGAATGGGTTGAAAAGGCC TCTGAAGAAGGTAACTGGTCAAAAAATTCAAAAACAATTACGCAATCATGGTTGAAGGAT GGTTTGAAGCCACGTTGTATTACAAGAGATTTAGTTTGGGGTACGCCAGTGCCTTTAGAA AAATATAAAGACAAAGTCTTGTACGTTTGGTTTGACGCTACAATCGGCTACGTTTCCATC ACTTCCAATTACACCAAAGAATGGAAACAATGGTGGAATAATCCAGAGCATGTTTCATTG TATCAATTCATGGGTAAGGACAATGTTCCTTTCCATACAGTTGTTTTCCCTGGTTCTCAA TTGGGTACGGAAGAGAACTGGACTATGTTGCACCATTTGAATACTACAGAATACTTACAA TATGAGAACGGTAAATTTTCTAAAAGTAGGGGTGTTGGTGTTTTTGGTAATAACGCTCAA GACTCTGGAATTTCTCCAAGTGTTTGGAGATACTACCTGGCATCTGTTAGACCAGAATCT AGTGATTCTCATTTCTCATGGGATGACTTTGTTGCTAGAAACAACAGTGAATTGTTGGCT AACTTGGGTAACTTTGTTAACAGATTAATTAAGTTTGTTAATGCCAAATATAATGGTGTT GTTCCAAAATTCGACCCCAAGAAGGTTTCCAATTATGATGGTTTAGTTAAAGATATCAAC GAAATTTTATCAAATTACGTCAAGGAAATGGAACTTGGACATGAAAGACGTGGTCTAGAA ATTGCCATGTCGTTAAGTGCTCGTGGTAACCAGTTTTTGCAAGAAAATAAGTTGGACAAT ACCTTGTTTTCACAGTCCCCAGAAAAGTCAGATGCTGTTGTCGCAGTTGGTTTGAATATT ATTTACGCTGTTAGCTCTATTATCACACCATATATGCCAGAAATAGGTGAGAAAATAAAC AAGATGTTAAATGCACCAGCTTTAAAAATTGATGATAGATTCCATTTGGCAATCCTAGAA GGACATAATATAAACAAGGCAGAATACTTGTTCCAACGTATTGATGAAAAGAAAATCGAT GAATGGAGAGCCAAATATGGTGGTCAACAAGTGTAA
Protein Properties
Pfam Domain Function
Protein Residues751
Protein Molecular Weight85677.39844
Protein Theoretical pI6.59
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Methionyl-tRNA synthetase, cytoplasmic MSFLISFDKSKKHPAHLQLANNLKIALALEYASKNLKPEVDNDNAAMELRNTKEPFLLFD ANAILRYVMDDFEGQTSDKYQFALASLQNLLYHKELPQQHVEVLTNKAIENYLVELKEPL TTTDLILFANVYALNSSLVHSKFPELPSKVHNAVALAKKHVPRDSSSFKNIGAVKIQADL TVKPKDSEILPKPNERNILITSALPYVNNVPHLGNIIGSVLSADIFARYCKGRNYNALFI CGTDEYGTATETKALEEGVTPRQLCDKYHKIHSDVYKWFQIGFDYFGRTTTDKQTEIAQH IFTKLNSNGYLEEQSMKQLYCPVHNSYLADRYVEGECPKCHYDDARGDQCDKCGALLDPF ELINPRCKLDDASPEPKYSDHIFLSLDKLESQISEWVEKASEEGNWSKNSKTITQSWLKD GLKPRCITRDLVWGTPVPLEKYKDKVLYVWFDATIGYVSITSNYTKEWKQWWNNPEHVSL YQFMGKDNVPFHTVVFPGSQLGTEENWTMLHHLNTTEYLQYENGKFSKSRGVGVFGNNAQ DSGISPSVWRYYLASVRPESSDSHFSWDDFVARNNSELLANLGNFVNRLIKFVNAKYNGV VPKFDPKKVSNYDGLVKDINEILSNYVKEMELGHERRGLEIAMSLSARGNQFLQENKLDN TLFSQSPEKSDAVVAVGLNIIYAVSSIITPYMPEIGEKINKMLNAPALKIDDRFHLAILE GHNINKAEYLFQRIDEKKIDEWRAKYGGQQV
References
External Links
ResourceLink
Saccharomyces Genome Database MES1
Uniprot IDP00958
Uniprot NameSYMC_YEAST
GenBank Gene IDV01316
Genebank Protein ID3924
General Reference
  • Walter, P., Gangloff, J., Bonnet, J., Boulanger, Y., Ebel, J. P., Fasiolo, F. (1983). "Primary structure of the Saccharomyces cerevisiae gene for methionyl-tRNA synthetase." Proc Natl Acad Sci U S A 80:2437-2441.6341994
  • Fasiolo, F., Gibson, B. W., Walter, P., Chatton, B., Biemann, K., Boulanger, Y. (1985). "Cytoplasmic methionyl-tRNA synthetase from Bakers' yeast. A monomer with a post-translationally modified N terminus." J Biol Chem 260:15571-15576.3905796
  • Clemente, M. L., Sartori, G., Cardazzo, B., Carignani, G. (1997). "Analysis of an 11.6 kb region from the right arm of chromosome VII of Saccharomyces cerevisiae between the RAD2 and the MES1 genes reveals the presence of three new genes." Yeast 13:287-290.9090059
  • Tettelin, H., Agostoni Carbone, M. L., Albermann, K., Albers, M., Arroyo, J., Backes, U., Barreiros, T., Bertani, I., Bjourson, A. J., Bruckner, M., Bruschi, C. V., Carignani, G., Castagnoli, L., Cerdan, E., Clemente, M. L., Coblenz, A., Coglievina, M., Coissac, E., Defoor, E., Del Bino, S., Delius, H., Delneri, D., de Wergifosse, P., Dujon, B., Kleine, K., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome VII." Nature 387:81-84.9169869
  • Gibson, B. W., Biemann, K. (1984). "Strategy for the mass spectrometric verification and correction of the primary structures of proteins deduced from their DNA sequences." Proc Natl Acad Sci U S A 81:1956-1960.6371805
  • Despons, L., Walter, P., Senger, B., Ebel, J. P., Fasiolo, F. (1991). "Identification of potential amino acid residues supporting anticodon recognition in yeast methionyl-tRNA synthetase." FEBS Lett 289:217-220.1915850
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Albuquerque, C. P., Smolka, M. B., Payne, S. H., Bafna, V., Eng, J., Zhou, H. (2008). "A multidimensional chromatography technology for in-depth phosphoproteome analysis." Mol Cell Proteomics 7:1389-1396.18407956