You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameThreonine dehydratase, mitochondrial
Synonyms
  • Threonine deaminase
Gene NameILV1
Enzyme Class
Biological Properties
General FunctionInvolved in catalytic activity
Specific FunctionL-threonine = 2-oxobutanoate + NH(3)
Cellular LocationMitochondrion
SMPDB PathwaysNot Available
KEGG Pathways
Glycine, serine and threonine metabolismec00260 Map00260
Valine, leucine and isoleucine biosynthesisec00290 Map00290
SMPDB ReactionsNot Available
KEGG Reactions
L-ThreonineAmmonium + 2-Ketobutyric acid
Metabolites
YMDB IDNameView
YMDB000712-Ketobutyric acidShow
YMDB00091AmmoniaShow
YMDB00214L-ThreonineShow
YMDB00423AmmoniumShow
GO Classification
Component
Not Available
Function
binding
cofactor binding
pyridoxal phosphate binding
carbon-nitrogen lyase activity
catalytic activity
ammonia-lyase activity
L-threonine ammonia-lyase activity
lyase activity
Process
cellular amino acid metabolic process
branched chain family amino acid metabolic process
metabolic process
isoleucine metabolic process
cellular metabolic process
isoleucine biosynthetic process
cellular amino acid and derivative metabolic process
Gene Properties
Chromosome Locationchromosome 5
LocusYER086W
Gene Sequence>1731 bp ATGTCAGCTACTCTACTAAAGCAACCATTATGTACGGTTGTTCGGCAAGGTAAACAGTCC AAAGTGTCTGGATTGAACCTTTTGAGACTAAAGGCTCATTTGCACAGACAACACCTGTCA CCTTCCTTGATAAAACTACACTCTGAATTGAAATTGGATGAGCTGCAAACTGATAACACC CCTGATTACGTCCGTTTAGTTTTAAGGTCCTCTGTATACGATGTTATTAATGAATCTCCA ATCTCTCAAGGTGTAGGTTTGTCTTCCCGTCTAAACACGAATGTCATCTTGAAAAGAGAA GATCTATTGCCTGTTTTCTCTTTCAAGCTTCGTGGTGCCTATAACATGATTGCCAAGTTG GACGATTCTCAAAGAAACCAGGGTGTTATTGCCTGTTCAGCTGGGAATCATGCCCAAGGT GTGGCCTTTGCTGCTAAACACTTGAAAATACCTGCTACTATCGTTATGCCTGTTTGTACA CCATCTATTAAGTATCAAAATGTCTCGAGATTAGGGTCTCAAGTCGTCCTATATGGTAAC GATTTTGACGAGGCTAAGGCTGAATGTGCCAAATTGGCTGAAGAGCGTGGCTTGACGAAC ATTCCTCCTTTCGATCATCCTTATGTCATTGCCGGTCAAGGTACTGTAGCTATGGAAATC CTAAGACAAGTACGTACCGCTAATAAGATCGGTGCTGTCTTTGTTCCCGTCGGCGGTGGT GGTTTAATTGCTGGTATTGGTGCTTATTTGAAAAGGGTTGCTCCTCATATCAAAACTATT GGTGTTGAAACTTACGATGCGGCCACTTTACATAATTCCTTGCAACGCAACCAGAGAACT CCTTTACCTGTGGTGGGTACTTTTGCCGATGGTACGTCTGTGCGTATGATTGGTGAAGAA ACATTTAGAGTCGCCCAACAAGTGGTTGATGAAGTTGTTCTTGTTAACACTGACGAAATC TGTGCTGCAGTAAAGGATATTTTTGAAGATACTAGAAGTATTGTAGAACCATCTGGTGCC CTTTCAGTAGCCGGTATGAAGAAATACATCTCTACCGTACATCCAGAAATTGACCACACT AAAAACACCTATGTTCCCATCCTTTCTGGTGCTAACATGAACTTTGATAGATTAAGATTT GTTTCCGAACGTGCTGTTCTTGGTGAAGGAAAGGAAGTCTTCATGTTAGTTACTTTACCC GACGTCCCTGGTGCGTTCAAGAAAATGCAAAAGATCATCCACCCAAGATCTGTCACTGAA TTCTCTTACCGTTACAATGAACATCGTCATGAGTCCTCTAGTGAAGTGCCCAAGGCTTAC ATTTACACTTCTTTCAGCGTCGTTGACAGAGAAAAGGAAATCAAGCAAGTTATGCAACAG TTGAATGCTTTAGGTTTTGAAGCTGTGGATATCTCCGATAACGAATTGGCTAAATCTCAT GGTAGATACTTGGTTGGTGGTGCTTCTAAGGTTCCTAATGAAAGAATTATTTCATTTGAA TTCCCTGAAAGACCAGGTGCCTTGACTAGGTTCCTTGGAGGCCTAAGCGATTCTTGGAAT CTTACTTTATTCCATTATAGAAACCATGGTGCCGATATCGGTAAGGTTTTAGCTGGTATT TCCGTTCCTCCAAGGGAAAACTTAACCTTCCAAAAATTCTTGGAAGATTTAGGCTACACT TATCATGATGAAACTGATAACACTGTTTATCAAAAATTCTTGAAATATTAA
Protein Properties
Pfam Domain Function
Protein Residues576
Protein Molecular Weight63830.69922
Protein Theoretical pI8.77
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Threonine dehydratase, mitochondrial MSATLLKQPLCTVVRQGKQSKVSGLNLLRLKAHLHRQHLSPSLIKLHSELKLDELQTDNT PDYVRLVLRSSVYDVINESPISQGVGLSSRLNTNVILKREDLLPVFSFKLRGAYNMIAKL DDSQRNQGVIACSAGNHAQGVAFAAKHLKIPATIVMPVCTPSIKYQNVSRLGSQVVLYGN DFDEAKAECAKLAEERGLTNIPPFDHPYVIAGQGTVAMEILRQVRTANKIGAVFVPVGGG GLIAGIGAYLKRVAPHIKIIGVETYDAATLHNSLQRNQRTPLPVVGTFADGTSVRMIGEE TFRVAQQVVDEVVLVNTDEICAAVKDIFEDTRSIVEPSGALSVAGMKKYISTVHPEIDHT KNTYVPILSGANMNFDRLRFVSERAVLGEGKEVFMLVTLPDVPGAFKKMQKIIHPRSVTE FSYRYNEHRHESSSEVPKAYIYTSFSVVDREKEIKQVMQQLNALGFEAVDISDNELAKSH GRYLVGGASKVPNERIISFEFPERPGALTRFLGGLSDSWNLTLFHYRNHGADIGKVLAGI SVPPRENLTFQKFLEDLGYTYHDETDNTVYQKFLKY
References
External Links
ResourceLink
Saccharomyces Genome Database ILV1
Uniprot IDP00927
Uniprot NameTHDH_YEAST
GenBank Gene IDM36383
Genebank Protein ID171752
General Reference
  • Dietrich, F. S., Mulligan, J., Hennessy, K., Yelton, M. A., Allen, E., Araujo, R., Aviles, E., Berno, A., Brennan, T., Carpenter, J., Chen, E., Cherry, J. M., Chung, E., Duncan, M., Guzman, E., Hartzell, G., Hunicke-Smith, S., Hyman, R. W., Kayser, A., Komp, C., Lashkari, D., Lew, H., Lin, D., Mosedale, D., Davis, R. W., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome V." Nature 387:78-81.9169868
  • Ahmed, S. I., Bollon, A. P., Rogers, S. J., Magee, P. T. (1976). "Purification and properties of threonine deaminase from Saccharomyces cerevisiae." Biochimie 58:225-232.782558
  • Holmberg, S., Petersen, J. G. (1988). "Regulation of isoleucine-valine biosynthesis in Saccharomyces cerevisiae." Curr Genet 13:207-217.3289762
  • Huh, W. K., Falvo, J. V., Gerke, L. C., Carroll, A. S., Howson, R. W., Weissman, J. S., O'Shea, E. K. (2003). "Global analysis of protein localization in budding yeast." Nature 425:686-691.14562095
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Sickmann, A., Reinders, J., Wagner, Y., Joppich, C., Zahedi, R., Meyer, H. E., Schonfisch, B., Perschil, I., Chacinska, A., Guiard, B., Rehling, P., Pfanner, N., Meisinger, C. (2003). "The proteome of Saccharomyces cerevisiae mitochondria." Proc Natl Acad Sci U S A 100:13207-13212.14576278
  • Reinders, J., Zahedi, R. P., Pfanner, N., Meisinger, C., Sickmann, A. (2006). "Toward the complete yeast mitochondrial proteome: multidimensional separation techniques for mitochondrial proteomics." J Proteome Res 5:1543-1554.16823961