You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameN-(5'-phosphoribosyl)anthranilate isomerase
Synonyms
  • PRAI
Gene NameTRP1
Enzyme Class
Biological Properties
General FunctionInvolved in catalytic activity
Specific FunctionN-(5-phospho-beta-D-ribosyl)anthranilate = 1- (2-carboxyphenylamino)-1-deoxy-D-ribulose 5-phosphate
Cellular LocationNot Available
SMPDB Pathways
Tryptophan metabolismPW002442 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Phenylalanine, tyrosine and tryptophan biosynthesisec00400 Map00400
Tryptophan metabolismec00380 Map00380
SMPDB Reactions
N-(5-Phosphonato-beta-D-ribosyl)anthranilate1-(2-carboxyphenylamino)-1-deoxy-D-ribulose 5-phosphate
KEGG Reactions
N-(5-phospho-beta-D-ribosyl)anthranilic acid1-(2-carboxyphenylamino)-1-deoxy-D-ribulose 5-phosphate
Metabolites
YMDB IDNameView
YMDB00054N-(5-phospho-beta-D-ribosyl)anthranilic acidShow
YMDB00217N-(5-Phospho-beta-D-ribosyl)anthranilic acid (Duplicate)Show
YMDB002511-(2-carboxyphenylamino)-1-deoxy-D-ribulose 5-phosphateShow
YMDB01005N-(5-Phosphonato-beta-D-ribosyl)anthranilateShow
GO Classification
Component
Not Available
Function
isomerase activity
intramolecular oxidoreductase activity
intramolecular oxidoreductase activity, interconverting aldoses and ketoses
phosphoribosylanthranilate isomerase activity
catalytic activity
Process
metabolic process
cellular amino acid derivative metabolic process
cellular biogenic amine metabolic process
indolalkylamine metabolic process
tryptophan metabolic process
cellular metabolic process
cellular amino acid and derivative metabolic process
Gene Properties
Chromosome Locationchromosome 4
LocusYDR007W
Gene Sequence>675 bp ATGTCTGTTATTAATTTCACAGGTAGTTCTGGTCCATTGGTGAAAGTTTGCGGCTTGCAG AGCACAGAGGCCGCAGAATGTGCTCTAGATTCCGATGCTGACTTGCTGGGTATTATATGT GTGCCCAATAGAAAGAGAACAATTGACCCGGTTATTGCAAGGAAAATTTCAAGTCTTGTA AAAGCATATAAAAATAGTTCAGGCACTCCGAAATACTTGGTTGGCGTGTTTCGTAATCAA CCTAAGGAGGATGTTTTGGCTCTGGTCAATGATTACGGCATTGATATCGTCCAACTGCAT GGAGATGAGTCGTGGCAAGAATACCAAGAGTTCCTCGGTTTGCCAGTTATTAAAAGACTC GTATTTCCAAAAGACTGCAACATACTACTCAGTGCAGCTTCACAGAAACCTCATTCGTTT ATTCCCTTGTTTGATTCAGAAGCAGGTGGGACAGGTGAACTTTTGGATTGGAACTCGATT TCTGACTGGGTTGGAAGGCAAGAGAGCCCCGAAAGCTTACATTTTATGTTAGCTGGTGGA CTGACGCCAGAAAATGTTGGTGATGCGCTTAGATTAAATGGCGTTATTGGTGTTGATGTA AGCGGAGGTGTGGAGACAAATGGTGTAAAAGACTCTAACAAAATAGCAAATTTCGTCAAA AATGCTAAGAAATAG
Protein Properties
Pfam Domain Function
Protein Residues224
Protein Molecular Weight24144.30078
Protein Theoretical pI5.08
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>N-(5'-phosphoribosyl)anthranilate isomerase MSVINFTGSSGPLVKVCGLQSTEAAECALDSDADLLGIICVPNRKRTIDPVIARKISSLV KAYKNSSGTPKYLVGVFRNQPKEDVLALVNDYGIDIVQLHGDESWQEYQEFLGLPVIKRL VFPKDCNILLSAASQKPHSFIPLFDSEAGGTGELLDWNSISDWVGRQESPESLHFMLAGG LTPENVGDALRLNGVIGVDVSGGVETNGVKDSNKIANFVKNAKK
References
External Links
ResourceLink
Saccharomyces Genome Database TRP1
Uniprot IDP00912
Uniprot NameTRPF_YEAST
GenBank Gene IDAJ585667
Genebank Protein ID45719938
General Reference
  • Tschumper, G., Carbon, J. (1980). "Sequence of a yeast DNA fragment containing a chromosomal replicator and the TRP1 gene." Gene 10:157-166.6248420
  • Brunelli, J. P., Pall, M. L. (1993). "A series of yeast shuttle vectors for expression of cDNAs and other DNA sequences." Yeast 9:1299-1308.8154181
  • Leh-Louis, V., Wirth, B., Despons, L., Wain-Hobson, S., Potier, S., Souciet, J. L. (2004). "Differential evolution of the Saccharomyces cerevisiae DUP240 paralogs and implication of recombination in phylogeny." Nucleic Acids Res 32:2069-2078.15087486
  • Jacq, C., Alt-Morbe, J., Andre, B., Arnold, W., Bahr, A., Ballesta, J. P., Bargues, M., Baron, L., Becker, A., Biteau, N., Blocker, H., Blugeon, C., Boskovic, J., Brandt, P., Bruckner, M., Buitrago, M. J., Coster, F., Delaveau, T., del Rey, F., Dujon, B., Eide, L. G., Garcia-Cantalejo, J. M., Goffeau, A., Gomez-Peris, A., Zaccaria, P., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome IV." Nature 387:75-78.9169867
  • Snyder, M., Buchman, A. R., Davis, R. W. (1986). "Bent DNA at a yeast autonomously replicating sequence." Nature 324:87-89.3785376
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106