Identification |
---|
Name | ATP synthase protein 8 |
---|
Synonyms | - A6L
- ATP-associated protein 1
- F-ATPase subunit 8
|
---|
Gene Name | ATP8 |
---|
Enzyme Class | Not Available |
---|
Biological Properties |
---|
General Function | Involved in hydrogen ion transmembrane transporter acti |
---|
Specific Function | Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F(1) - containing the extramembraneous catalytic core and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Part of the complex F(0) domain. Minor subunit located with subunit a in the membrane |
---|
Cellular Location | Mitochondrion membrane; Single-pass membrane protein |
---|
SMPDB Pathways | Not Available |
---|
KEGG Pathways | Not Available |
---|
SMPDB Reactions | Not Available |
---|
KEGG Reactions | Not Available |
---|
Metabolites | |
---|
GO Classification | Component |
---|
cell part | membrane part | mitochondrial proton-transporting ATP synthase complex, coupling factor F(o) | mitochondrial membrane part | Function |
---|
hydrogen ion transmembrane transporter activity | transporter activity | transmembrane transporter activity | substrate-specific transmembrane transporter activity | ion transmembrane transporter activity | cation transmembrane transporter activity | inorganic cation transmembrane transporter activity | monovalent inorganic cation transmembrane transporter activity | Process |
---|
nitrogen compound metabolic process | cellular nitrogen compound metabolic process | nucleobase, nucleoside, nucleotide and nucleic acid metabolic process | nucleobase, nucleoside and nucleotide metabolic process | nucleoside phosphate metabolic process | nucleotide metabolic process | metabolic process | purine nucleotide metabolic process | purine nucleotide biosynthetic process | purine nucleoside triphosphate biosynthetic process | purine ribonucleoside triphosphate biosynthetic process | ATP biosynthetic process | ATP synthesis coupled proton transport |
|
---|
Gene Properties |
---|
Chromosome Location | Not Available |
---|
Locus | |
---|
Gene Sequence | >147 bp
ATGCCACAATTAGTTCCATTTTATTTTATGAATCAATTAACATATGGTTTCTTATTAATG
ATTCTATTATTAATTTTATTCTCACAATTCTTTTTACCTATGATCTTAAGATTATATGTA
TCTAGATTATTTATTTCTAAATTATAA |
---|
Protein Properties |
---|
Pfam Domain Function | |
---|
Protein Residues | 48 |
---|
Protein Molecular Weight | 5822.2002 |
---|
Protein Theoretical pI | 10.27 |
---|
Signalling Regions | |
---|
Transmembrane Regions | |
---|
Protein Sequence | >ATP synthase protein 8
MPQLVPFYFMNQLTYGFLLMITLLILFSQFFLPMILRLYVSRLFISKL |
---|
References |
---|
External Links | |
---|
General Reference | - Macreadie, I. G., Novitski, C. E., Maxwell, R. J., John, U., Ooi, B. G., McMullen, G. L., Lukins, H. B., Linnane, A. W., Nagley, P. (1983). "Biogenesis of mitochondria: the mitochondrial gene (aap1) coding for mitochondrial ATPase subunit 8 in Saccharomyces cerevisiae." Nucleic Acids Res 11:4435-4451.6223276
- Simon, M., Faye, G. (1984). "Organization and processing of the mitochondrial oxi3/oli2 multigenic transcript in yeast." Mol Gen Genet 196:266-274.6387398
- Foury, F., Roganti, T., Lecrenier, N., Purnelle, B. (1998). "The complete sequence of the mitochondrial genome of Saccharomyces cerevisiae." FEBS Lett 440:325-331.9872396
|
---|