You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameInorganic pyrophosphatase
Synonyms
  • Pyrophosphate phospho-hydrolase
  • PPase
Gene NameIPP1
Enzyme Class
Biological Properties
General FunctionInvolved in magnesium ion binding
Specific FunctionDiphosphate + H(2)O = 2 phosphate
Cellular LocationCytoplasm
SMPDB Pathways
Oxidative phosphorylationPW002461 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Oxidative phosphorylationec00190 Map00190
SMPDB ReactionsNot Available
KEGG Reactions
Pyrophosphate + waterphosphate + hydron
Metabolites
YMDB IDNameView
YMDB00219PyrophosphateShow
YMDB00862hydronShow
YMDB00890waterShow
YMDB00907phosphateShow
GO Classification
Component
cell part
intracellular part
cytoplasm
Function
inorganic diphosphatase activity
binding
ion binding
cation binding
metal ion binding
hydrolase activity
magnesium ion binding
hydrolase activity, acting on acid anhydrides
hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides
catalytic activity
pyrophosphatase activity
Process
metabolic process
cellular metabolic process
phosphorus metabolic process
phosphate metabolic process
Gene Properties
Chromosome Locationchromosome 2
LocusYBR011C
Gene Sequence>864 bp ATGACCTACACTACCAGACAAATTGGTGCCAAGAACACCTTGGAATACAAAGTTTATATC GAAAAGGATGGTAAGCCAGTTTCTGCCTTCCACGACATTCCCTTGTACGCTGACAAGGAA AACAACATTTTCAACATGGTTGTTGAAATTCCACGTTGGACCAACGCCAAGTTAGAAATC ACCAAGGAAGAAACTTTGAACCCAATCATCCAAGACACCAAGAAGGGCAAGTTGAGATTT GTTAGAAACTGTTTCCCTCACCATGGTTACATTCACAACTATGGTGCTTTCCCACAAACT TGGGAAGACCCAAACGTAAGCCACCCAGAAACTAAGGCAGTTGGTGACAACGATCCAATT GATGTGTTGGAAATTGGTGAAACTATTGCTTACACTGGTCAAGTCAAGCAAGTTAAGGCT CTAGGTATCATGGCTTTATTGGATGAAGGTGAGACCGATTGGAAAGTTATTGCCATTGAT ATTAACGATCCATTAGCCCCAAAATTGAACGACATTGAGGATGTTGAGAAATACTTCCCA GGTCTGTTGAGGGCTACTAACGAATGGTTCAGAATTTACAAAATCCCAGATGGTAAGCCA GAAAACCAATTTGCCTTCTCCGGTGAAGCTAAGAACAAGAAGTACGCTTTGGATATCATC AAGGAAACACATGACTCCTGGAAACAATTAATTGCTGGTAAGTCTTCTGACAGCAAGGGT ATTGATTTGACCAATGTTACTTTGCCTGACACCCCAACCTACTCCAAGGCTGCCTCTGAT GCCATCCCACCAGCTTCTCCAAAGGCAGATGCTCCAATTGACAAGTCTATTGACAAGTGG TTCTTCATCTCCGGTTCTGTTTAA
Protein Properties
Pfam Domain Function
Protein Residues287
Protein Molecular Weight32299.30078
Protein Theoretical pI5.25
PDB Fileshow
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Inorganic pyrophosphatase MTYTTRQIGAKNTLEYKVYIEKDGKPVSAFHDIPLYADKENNIFNMVVEIPRWTNAKLEI TKEETLNPIIQDTKKGKLRFVRNCFPHHGYIHNYGAFPQTWEDPNVSHPETKAVGDNDPI DVLEIGETIAYTGQVKQVKALGIMALLDEGETDWKVIAIDINDPLAPKLNDIEDVEKYFP GLLRATNEWFRIYKIPDGKPENQFAFSGEAKNKKYALDIIKETHDSWKQLIAGKSSDSKG IDLTNVTLPDTPTYSKAASDAIPPASPKADAPIDKSIDKWFFISGSV
References
External Links
ResourceLink
Saccharomyces Genome Database IPP1
Uniprot IDP00817
Uniprot NameIPYR_YEAST
GenBank Gene IDAY692953
Genebank Protein ID51013357
PDB ID
1M38
General Reference
  • Kolakowski, L. F. Jr, Schloesser, M., Cooperman, B. S. (1988). "Cloning, molecular characterization and chromosome localization of the inorganic pyrophosphatase (PPA) gene from S. cerevisiae." Nucleic Acids Res 16:10441-10452.2849749
  • Feldmann, H., Aigle, M., Aljinovic, G., Andre, B., Baclet, M. C., Barthe, C., Baur, A., Becam, A. M., Biteau, N., Boles, E., Brandt, T., Brendel, M., Bruckner, M., Bussereau, F., Christiansen, C., Contreras, R., Crouzet, M., Cziepluch, C., Demolis, N., Delaveau, T., Doignon, F., Domdey, H., Dusterhus, S., Dubois, E., Dujon, B., El Bakkoury, M., Entian, K. D., Feurmann, M., Fiers, W., Fobo, G. M., Fritz, C., Gassenhuber, H., Glandsdorff, N., Goffeau, A., Grivell, L. A., de Haan, M., Hein, C., Herbert, C. J., Hollenberg, C. P., Holmstrom, K., Jacq, C., Jacquet, M., Jauniaux, J. C., Jonniaux, J. L., Kallesoe, T., Kiesau, P., Kirchrath, L., Kotter, P., Korol, S., Liebl, S., Logghe, M., Lohan, A. J., Louis, E. J., Li, Z. Y., Maat, M. J., Mallet, L., Mannhaupt, G., Messenguy, F., Miosga, T., Molemans, F., Muller, S., Nasr, F., Obermaier, B., Perea, J., Pierard, A., Piravandi, E., Pohl, F. M., Pohl, T. M., Potier, S., Proft, M., Purnelle, B., Ramezani Rad, M., Rieger, M., Rose, M., Schaaff-Gerstenschlager, I., Scherens, B., Schwarzlose, C., Skala, J., Slonimski, P. P., Smits, P. H., Souciet, J. L., Steensma, H. Y., Stucka, R., Urrestarazu, A., van der Aart, Q. J., van Dyck, L., Vassarotti, A., Vetter, I., Vierendeels, F., Vissers, S., Wagner, G., de Wergifosse, P., Wolfe, K. H., Zagulski, M., Zimmermann, F. K., Mewes, H. W., Kleine, K. (1994). "Complete DNA sequence of yeast chromosome II." EMBO J 13:5795-5809.7813418
  • Hu, Y., Rolfs, A., Bhullar, B., Murthy, T. V., Zhu, C., Berger, M. F., Camargo, A. A., Kelley, F., McCarron, S., Jepson, D., Richardson, A., Raphael, J., Moreira, D., Taycher, E., Zuo, D., Mohr, S., Kane, M. F., Williamson, J., Simpson, A., Bulyk, M. L., Harlow, E., Marsischky, G., Kolodner, R. D., LaBaer, J. (2007). "Approaching a complete repository of sequence-verified protein-encoding clones for Saccharomyces cerevisiae." Genome Res 17:536-543.17322287
  • Cohen, S. A., Sterner, R., Keim, P. S., Heinrikson, R. L. (1978). "Covalent structural analysis of yeast inorganic pyrophosphatase." J Biol Chem 253:889-897.340461
  • Garrels, J. I., Futcher, B., Kobayashi, R., Latter, G. I., Schwender, B., Volpe, T., Warner, J. R., McLaughlin, C. S. (1994). "Protein identifications for a Saccharomyces cerevisiae protein database." Electrophoresis 15:1466-1486.7895733
  • Norbeck, J., Blomberg, A. (1996). "Protein expression during exponential growth in 0.7 M NaCl medium of Saccharomyces cerevisiae." FEMS Microbiol Lett 137:1-8.8935650
  • Raznikov, A. V., Sklyankina, V. A., Avaeva, S. M. (1992). "Tyrosine-89 is important for enzymatic activity of S. cerevisiae inorganic pyrophosphatase." FEBS Lett 308:62-64.1322842
  • Bond, M. W., Chiu, N. Y., Cooperman, B. S. (1980). "Identification of an arginine important for enzymatic activity within the covalent structure of yeast inorganic pyrophosphatase." Biochemistry 19:94-102.6101539
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Gruhler, A., Olsen, J. V., Mohammed, S., Mortensen, P., Faergeman, N. J., Mann, M., Jensen, O. N. (2005). "Quantitative phosphoproteomics applied to the yeast pheromone signaling pathway." Mol Cell Proteomics 4:310-327.15665377
  • Li, X., Gerber, S. A., Rudner, A. D., Beausoleil, S. A., Haas, W., Villen, J., Elias, J. E., Gygi, S. P. (2007). "Large-scale phosphorylation analysis of alpha-factor-arrested Saccharomyces cerevisiae." J Proteome Res 6:1190-1197.17330950
  • Smolka, M. B., Albuquerque, C. P., Chen, S. H., Zhou, H. (2007). "Proteome-wide identification of in vivo targets of DNA damage checkpoint kinases." Proc Natl Acad Sci U S A 104:10364-10369.17563356
  • Albuquerque, C. P., Smolka, M. B., Payne, S. H., Bafna, V., Eng, J., Zhou, H. (2008). "A multidimensional chromatography technology for in-depth phosphoproteome analysis." Mol Cell Proteomics 7:1389-1396.18407956
  • Heikinheimo, P., Lehtonen, J., Baykov, A., Lahti, R., Cooperman, B. S., Goldman, A. (1996). "The structural basis for pyrophosphatase catalysis." Structure 4:1491-1508.8994974
  • Tuominen, V., Heikinheimo, P., Kajander, T., Torkkel, T., Hyytia, T., Kapyla, J., Lahti, R., Cooperman, B. S., Goldman, A. (1998). "The R78K and D117E active-site variants of Saccharomyces cerevisiae soluble inorganic pyrophosphatase: structural studies and mechanistic implications." J Mol Biol 284:1565-1580.9878371
  • Lahti, R., Kolakowski, L. F. Jr, Heinonen, J., Vihinen, M., Pohjanoksa, K., Cooperman, B. S. (1990). "Conservation of functional residues between yeast and E. coli inorganic pyrophosphatases." Biochim Biophys Acta 1038:338-345.2160278