You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameArginase
SynonymsNot Available
Gene NameCAR1
Enzyme Class
Biological Properties
General FunctionInvolved in arginase activity
Specific FunctionL-arginine + H(2)O = L-ornithine + urea
Cellular LocationCytoplasmic
SMPDB Pathways
Glutamate MetabolismPW002376 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Arginine and proline metabolismec00330 Map00330
SMPDB Reactions
L-Arginine + waterOrnithine + Urea
KEGG Reactions
L-Arginine + waterOrnithine + Urea
Metabolites
YMDB IDNameView
YMDB00003UreaShow
YMDB00353OrnithineShow
YMDB00592L-ArginineShow
YMDB00890waterShow
GO Classification
Component
Not Available
Function
binding
ion binding
cation binding
metal ion binding
hydrolase activity
hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds
hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in linear amidines
arginase activity
catalytic activity
Process
metabolic process
cellular metabolic process
cellular amino acid and derivative metabolic process
cellular amino acid metabolic process
glutamine family amino acid metabolic process
arginine metabolic process
Gene Properties
Chromosome Locationchromosome 16
LocusYPL111W
Gene Sequence>1002 bp ATGGAAACAGGACCTCATTACAACTACTACAAAAATCGCGAATTGTCCATCGTTCTGGCT CCATTCAGCGGCGGTCAGGGTAAGCTTGGTGTCGAGAAGGGCCCTAAATACATGCTTAAG CATGGTCTGCAAACAAGCATAGAGGATTTGGGCTGGTCTACGGAATTAGAGCCCTCAATG GACGAGGCCCAATTTGTGGGAAAGTTGAAAATGGAGAAGGACTCCACAACTGGGGGTTCC TCTGTTATGATAGACGGTGTCAAGGCTAAAAGAGCAGATTTGGTTGGTGAAGCCACCAAG TTGGTGTACAACTCCGTGTCGAAAGTGGTCCAGGCGAACAGATTCCCCTTGACCTTGGGT GGTGATCATTCAATAGCCATTGGTACTGTATCCGCGGTTTTGGACAAATACCCCGATGCT GGTCTTTTATGGATAGACGCCCACGCTGATATAAACACCATAGAAAGCACCCCCTCTGGA AACTTGCACGGCTGTCCCGTGTCATTCCTAATGGGTTTGAACAAGGATGTCCCACATTGT CCCGAGTCGCTCAAATGGGTTCCAGGCAACTTGAGCCCAAAAAAGATCGCGTATATTGGG TTGAGAGATGTTGATGCCGGAGAAAAGAAAATCTTGAAAGATCTGGGTATCGCCGCCTTT TCCATGTACCACGTTGACAAATACGGCATCAACGCTGTCATTGAAATGGCAATGAAAGCC GTGCACCCAGAAACAAACGGTGAAGGTCCCATTATGTGCTCCTATGACGTCGATGGTGTA GACCCATTATACATTCCTGCTACAGGTACTCCAGTGAGAGGTGGGTTGACCTTGAGAGAA GGTCTTTTCTTGGTGGAAAGATTGGCCGAATCCGGTAATTTAATTGCGCTAGACGTTGTT GAATGTAACCCTGATCTGGCTATTCATGATATCCATGTTTCAAACACCATCTCTGCAGGT TGCGCCATTGCAAGGTGTGCATTGGGTGAAACCTTATTGTAG
Protein Properties
Pfam Domain Function
Protein Residues333
Protein Molecular Weight35661.60156
Protein Theoretical pI5.38
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Arginase METGPHYNYYKNRELSIVLAPFSGGQGKLGVEKGPKYMLKHGLQTSIEDLGWSTELEPSM DEAQFVGKLKMEKDSTTGGSSVMIDGVKAKRADLVGEATKLVYNSVSKVVQANRFPLTLG GDHSIAIGTVSAVLDKYPDAGLLWIDAHADINTIESTPSGNLHGCPVSFLMGLNKDVPHC PESLKWVPGNLSPKKIAYIGLRDVDAGEKKILKDLGIAAFSMYHVDKYGINAVIEMAMKA VHPETNGEGPIMCSYDVDGVDPLYIPATGTPVRGGLTLREGLFLVERLAESGNLIALDVV ECNPDLAIHDIHVSNTISAGCAIARCALGETLL
References
External Links
ResourceLink
Saccharomyces Genome Database CAR1
Uniprot IDP00812
Uniprot NameARGI_YEAST
GenBank Gene IDM10110
Genebank Protein ID171161
General Reference
  • Sumrada, R. A., Cooper, T. G. (1984). "Nucleotide sequence of the Saccharomyces cerevisiae arginase gene (CAR1) and its transcription under various physiological conditions." J Bacteriol 160:1078-1087.6094498
  • Bussey, H., Storms, R. K., Ahmed, A., Albermann, K., Allen, E., Ansorge, W., Araujo, R., Aparicio, A., Barrell, B., Badcock, K., Benes, V., Botstein, D., Bowman, S., Bruckner, M., Carpenter, J., Cherry, J. M., Chung, E., Churcher, C., Coster, F., Davis, K., Davis, R. W., Dietrich, F. S., Delius, H., DiPaolo, T., Hani, J., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome XVI." Nature 387:103-105.9169875
  • Sumrada, R. A., Cooper, T. G. (1985). "Point mutation generates constitutive expression of an inducible eukaryotic gene." Proc Natl Acad Sci U S A 82:643-647.2983306
  • Green, S. M., Ginsburg, A., Lewis, M. S., Hensley, P. (1991). "Roles of metal ions in the maintenance of the tertiary and quaternary structure of arginase from Saccharomyces cerevisiae." J Biol Chem 266:21474-21481.1939179
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Albuquerque, C. P., Smolka, M. B., Payne, S. H., Bafna, V., Eng, J., Zhou, H. (2008). "A multidimensional chromatography technology for in-depth phosphoproteome analysis." Mol Cell Proteomics 7:1389-1396.18407956