You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NamePyruvate kinase 1
Synonyms
  • PK 1
Gene NamePYK1
Enzyme Class
Biological Properties
General FunctionInvolved in magnesium ion binding
Specific FunctionATP + pyruvate = ADP + phosphoenolpyruvate
Cellular LocationNot Available
SMPDB Pathways
Glycolysis IPW002386 ThumbThumb?image type=greyscaleThumb?image type=simple
Pyruvate metabolismPW002447 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Glycolysis / Gluconeogenesisec00010 Map00010
Purine metabolismec00230 Map00230
Pyruvate metabolismec00620 Map00620
SMPDB Reactions
Adenosine triphosphate + Pyruvic acidADP + Phosphoenolpyruvic acid
Adenosine triphosphate + Pyruvic acidADP + Phosphoenolpyruvic acid
KEGG Reactions
Phosphoenolpyruvic acid + hydron + ADPPyruvic acid + Adenosine triphosphate
Metabolites
YMDB IDNameView
YMDB00109Adenosine triphosphateShow
YMDB00175Pyruvic acidShow
YMDB00276Phosphoenolpyruvic acidShow
YMDB00862hydronShow
YMDB00914ADPShow
GO Classification
Component
Not Available
Function
pyruvate kinase activity
catalytic activity
transferase activity
transferase activity, transferring phosphorus-containing groups
magnesium ion binding
binding
ion binding
cation binding
alkali metal ion binding
metal ion binding
potassium ion binding
kinase activity
Process
small molecule metabolic process
alcohol metabolic process
monosaccharide metabolic process
metabolic process
hexose metabolic process
glucose metabolic process
glucose catabolic process
glycolysis
Gene Properties
Chromosome LocationNot Available
LocusYAL038W
Gene Sequence>1503 bp ATGTCTAGATTAGAAAGATTGACCTCATTAAACGTTGTTGCTGGTTCTGACTTGAGAAGA ACCTCCATCATTGGTACCATCGGTCCAAAGACCAACAACCCAGAAACCTTGGTTGCTTTG AGAAAGGCTGGTTTGAACATTGTCCGTATGAACTTCTCTCACGGTTCTTACGAATACCAC AAGTCTGTCATTGACAACGCCAGAAAGTCCGAAGAATTGTACCCAGGTAGGCCATTGGCC ATTGCTTTGGACACCAAGGGTCCAGAAATCAGAACTGGTACCACCACCAACGATGTTGAC TACCCAATCCCACCAAACCACGAAATGATCTTCACCACCGATGACAAGTACGCTAAGGCT TGTGACGACAAGATCATGTACGTTGACTACAAGAACATCACCAAGGTCATCTCCGCTGGT AGAATCATCTACGTTGATGATGGTGTTTTGTCTTTCCAAGTTTTGGAAGTCGTTGACGAC AAGACTTTGAAGGTCAAGGCTTTGAACGCCGGTAAGATCTGTTCCCACAAGGGTGTCAAC TTACCAGGTACCGATGTCGATTTGCCAGCTTTGTCTGAAAAGGACAAGGAAGATTTGAGA TTCGGTGTCAAGAACGGTGTCCACATGGTCTTCGCTTCTTTCATCAGAACCGCCAACGAT GTTTTGACCATCAGAGAAGTCTTGGGTGAACAAGGTAAGGACGTCAAGATCATTGTCAAG ATTGAAAACCAACAAGGTGTTAACAACTTCGACGAAATCTTGAAGGTCACTGACGGTGTT ATGGTTGCCAGAGGTGACTTGGGTATTGAAATCCCAGCCCCAGAAGTCTTGGCTGTCCAA AAGAAATTGATTGCTAAGTCTAACTTGGCTGGTAAGCCAGTTATCTGTGCTACCCAAATG TTGGAATCCATGACTTACAACCCAAGACCAACCAGAGCTGAAGTTTCCGATGTCGGTAAC GCTATCTTGGATGGTGCTGACTGTGTTATGTTGTCTGGTGAAACCGCCAAGGGTAACTAC CCAATCAACGCCGTTACCACTATGGCTGAAACCGCTGTCATTGCTGAACAAGCTATCGCT TACTTGCCAAACTACGATGACATGAGAAACTGTACTCCAAAGCCAACCTCCACCACCGAA ACCGTCGCTGCCTCCGCTGTCGCTGCTGTTTTCGAACAAAAGGCCAAGGCTATCATTGTC TTGTCCACTTCCGGTACCACCCCAAGATTGGTTTCCAAGTACAGACCAAACTGTCCAATC ATCTTGGTTACCAGATGCCCAAGAGCTGCTAGATTCTCTCACTTGTACAGAGGTGTCTTC CCATTCGTTTTCGAAAAGGAACCTGTCTCTGACTGGACTGATGATGTTGAAGCCCGTATC AACTTCGGTATTGAAAAGGCTAAGGAATTCGGTATCTTGAAGAAGGGTGACACTTACGTT TCCATCCAAGGTTTCAAGGCCGGTGCTGGTCACTCCAACACTTTGCAAGTCTCTACCGTT TAA
Protein Properties
Pfam Domain Function
Protein Residues500
Protein Molecular Weight54544.10156
Protein Theoretical pI7.78
PDB Fileshow
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Pyruvate kinase 1 MSRLERLTSLNVVAGSDLRRTSIIGTIGPKTNNPETLVALRKAGLNIVRMNFSHGSYEYH KSVIDNARKSEELYPGRPLAIALDTKGPEIRTGTTTNDVDYPIPPNHEMIFTTDDKYAKA CDDKIMYVDYKNITKVISAGRIIYVDDGVLSFQVLEVVDDKTLKVKALNAGKICSHKGVN LPGTDVDLPALSEKDKEDLRFGVKNGVHMVFASFIRTANDVLTIREVLGEQGKDVKIIVK IENQQGVNNFDEILKVTDGVMVARGDLGIEIPAPEVLAVQKKLIAKSNLAGKPVICATQM LESMTYNPRPTRAEVSDVGNAILDGADCVMLSGETAKGNYPINAVTTMAETAVIAEQAIA YLPNYDDMRNCTPKPTSTTETVAASAVAAVFEQKAKAIIVLSTSGTTPRLVSKYRPNCPI ILVTRCPRAARFSHLYRGVFPFVFEKEPVSDWTDDVEARINFGIEKAKEFGILKKGDTYV SIQGFKAGAGHSNTLQVSTV
References
External Links
ResourceLink
Saccharomyces Genome Database PYK1
Uniprot IDP00549
Uniprot NameKPYK1_YEAST
GenBank Gene IDAY693107
Genebank Protein ID51013665
PDB ID
1A3X
General Reference
  • McNally, T., Purvis, I. J., Fothergill-Gilmore, L. A., Brown, A. J. (1989). "The yeast pyruvate kinase gene does not contain a string of non-preferred codons: revised nucleotide sequence." FEBS Lett 247:312-316.2653861
  • Burke, R. L., Tekamp-Olson, P., Najarian, R. (1983). "The isolation, characterization, and sequence of the pyruvate kinase gene of Saccharomyces cerevisiae." J Biol Chem 258:2193-2201.6185493
  • Aa, E., Townsend, J. P., Adams, R. I., Nielsen, K. M., Taylor, J. W. (2006). "Population structure and gene evolution in Saccharomyces cerevisiae." FEMS Yeast Res 6:702-715.16879422
  • Bussey, H., Kaback, D. B., Zhong, W., Vo, D. T., Clark, M. W., Fortin, N., Hall, J., Ouellette, B. F., Keng, T., Barton, A. B., et, a. l. .. (1995). "The nucleotide sequence of chromosome I from Saccharomyces cerevisiae." Proc Natl Acad Sci U S A 92:3809-3813.7731988
  • Hu, Y., Rolfs, A., Bhullar, B., Murthy, T. V., Zhu, C., Berger, M. F., Camargo, A. A., Kelley, F., McCarron, S., Jepson, D., Richardson, A., Raphael, J., Moreira, D., Taycher, E., Zuo, D., Mohr, S., Kane, M. F., Williamson, J., Simpson, A., Bulyk, M. L., Harlow, E., Marsischky, G., Kolodner, R. D., LaBaer, J. (2007). "Approaching a complete repository of sequence-verified protein-encoding clones for Saccharomyces cerevisiae." Genome Res 17:536-543.17322287
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Gruhler, A., Olsen, J. V., Mohammed, S., Mortensen, P., Faergeman, N. J., Mann, M., Jensen, O. N. (2005). "Quantitative phosphoproteomics applied to the yeast pheromone signaling pathway." Mol Cell Proteomics 4:310-327.15665377
  • Li, X., Gerber, S. A., Rudner, A. D., Beausoleil, S. A., Haas, W., Villen, J., Elias, J. E., Gygi, S. P. (2007). "Large-scale phosphorylation analysis of alpha-factor-arrested Saccharomyces cerevisiae." J Proteome Res 6:1190-1197.17330950
  • Chi, A., Huttenhower, C., Geer, L. Y., Coon, J. J., Syka, J. E., Bai, D. L., Shabanowitz, J., Burke, D. J., Troyanskaya, O. G., Hunt, D. F. (2007). "Analysis of phosphorylation sites on proteins from Saccharomyces cerevisiae by electron transfer dissociation (ETD) mass spectrometry." Proc Natl Acad Sci U S A 104:2193-2198.17287358
  • Smolka, M. B., Albuquerque, C. P., Chen, S. H., Zhou, H. (2007). "Proteome-wide identification of in vivo targets of DNA damage checkpoint kinases." Proc Natl Acad Sci U S A 104:10364-10369.17563356
  • Albuquerque, C. P., Smolka, M. B., Payne, S. H., Bafna, V., Eng, J., Zhou, H. (2008). "A multidimensional chromatography technology for in-depth phosphoproteome analysis." Mol Cell Proteomics 7:1389-1396.18407956
  • Jurica, M. S., Mesecar, A., Heath, P. J., Shi, W., Nowak, T., Stoddard, B. L. (1998). "The allosteric regulation of pyruvate kinase by fructose-1,6-bisphosphate." Structure 6:195-210.9519410