You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameATP phosphoribosyltransferase
Synonyms
  • ATP-PRT
  • ATP-PRTase
Gene NameHIS1
Enzyme Class
Biological Properties
General FunctionInvolved in ATP phosphoribosyltransferase activity
Specific FunctionCatalyzes the condensation of ATP and 5-phosphoribose 1- diphosphate to form N'-(5'-phosphoribosyl)-ATP (PR-ATP). Has a crucial role in the pathway because the rate of histidine biosynthesis seems to be controlled primarily by regulation of the enzymatic activity
Cellular LocationCytoplasm
SMPDB Pathways
Histidine BiosynthesisPW002418 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Histidine metabolismec00340 Map00340
SMPDB Reactions
Phosphoribosyl pyrophosphate + Adenosine triphosphate + hydronPyrophosphate + 1-(5-phosphoribosyl)-5'-AMP
Phosphoribosyl pyrophosphate + Adenosine triphosphate + hydronPyrophosphate + 1-(5-phosphoribosyl)-ATP
KEGG Reactions
Adenosine triphosphate + Phosphoribosyl pyrophosphatePyrophosphate + 5-phosphoribosyl-ATP
Metabolites
YMDB IDNameView
YMDB00109Adenosine triphosphateShow
YMDB00165Phosphoribosyl-ATPShow
YMDB00219PyrophosphateShow
YMDB00402Phosphoribosyl pyrophosphateShow
YMDB00862hydronShow
YMDB008681-(5-phosphoribosyl)-5'-AMPShow
YMDB162741-(5-phosphoribosyl)-ATPShow
GO Classification
Component
cell part
intracellular part
cytoplasm
Function
ion binding
catalytic activity
cation binding
transferase activity
metal ion binding
transferase activity, transferring glycosyl groups
magnesium ion binding
ATP phosphoribosyltransferase activity
binding
transferase activity, transferring pentosyl groups
Process
histidine biosynthetic process
metabolic process
cellular metabolic process
cellular amino acid and derivative metabolic process
cellular amino acid metabolic process
histidine family amino acid metabolic process
histidine metabolic process
Gene Properties
Chromosome Locationchromosome 5
LocusYER055C
Gene Sequence>894 bp ATGGATTTGGTGAACCATCTAACCGATAGACTACTGTTTGCAATCCCAAAGAAAGGTCGT TTATATTCTAAAAGTGTTTCTATTTTGAATGGTGCTGATATTACCTTTCACCGCTCTCAA AGATTAGACATTGCACTAAGCACAAGCTTACCTGTAGCGTTGGTCTTTCTGCCCGCTGCA GATATTCCAACTTTTGTTGGTGAAGGTAAATGTGATCTTGGTATAACTGGTGTTGACCAA GTTCGTGAATCTAACGTCGACGTAGACTTAGCAATCGATTTGCAATTTGGTAACTGTAAA TTGCAGGTACAAGTCCCCGTAAATGGCGAGTATAAAAAGCCAGAACAGTTAATTGGCAAA ACCATTGTTACCAGTTTCGTGAAACTTGCTGAAAAATACTTTGCCGATTTGGAAGGTACT ACTGTTGAAAAAATGACCACAAGGATAAAGTTTGTCAGTGGTTCCGTGGAGGCATCATGT GCTCTGGGAATTGGTGATGCTATTGTAGATCTTGTAGAGAGTGGTGAGACAATGAGGGCA GCAGGTTTAGTTGATATTGCCACCGTCCTAAGCACAAGTGCCTACCTAATAGAATCAAAG AACCCAAAGAGCGATAAGAGTTTGATTGCTACTATCAAATCAAGAATTGAAGGTGTCATG ACCGCTCAAAGGTTCGTTTCATGTATTTATAACGCACCTGAAGACAAGCTGCCTGAACTG TTGAAGGTGACGCCTGGCCGTAGAGCACCAACCATTTCCAAAATTGACGATGAAGGATGG GTTGCTGTTAGTTCCATGATTGAGAGAAAAACGAAGGGTGTTGTTTTAGATGAATTGAAA AGACTCGGCGCATCTGATATCATGGTTTTCGAAATTTCTAATTGTCGTGTATAA
Protein Properties
Pfam Domain Function
Protein Residues297
Protein Molecular Weight32266.09961
Protein Theoretical pI5.94
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>ATP phosphoribosyltransferase MDLVNHLTDRLLFAIPKKGRLYSKSVSILNGADITFHRSQRLDIALSTSLPVALVFLPAA DIPTFVGEGKCDLGITGVDQVRESNVDVDLAIDLQFGNCKLQVQVPVNGEYKKPEQLIGK TIVTSFVKLAEKYFADLEGTTVEKMTTRIKFVSGSVEASCALGIGDAIVDLVESGETMRA AGLVDIATVLSTSAYLIESKNPKSDKSLIATIKSRIEGVMTAQRFVSCIYNAPEDKLPEL LKVTPGRRAPTISKIDDEGWVAVSSMIERKTKGVVLDELKRLGASDIMVFEISNCRV
References
External Links
ResourceLink
Saccharomyces Genome Database HIS1
Uniprot IDP00498
Uniprot NameHIS1_YEAST
GenBank Gene IDU18813
Genebank Protein ID603291
General Reference
  • Hinnebusch, A. G., Fink, G. R. (1983). "Repeated DNA sequences upstream from HIS1 also occur at several other co-regulated genes in Saccharomyces cerevisiae." J Biol Chem 258:5238-5247.6300123
  • Dietrich, F. S., Mulligan, J., Hennessy, K., Yelton, M. A., Allen, E., Araujo, R., Aviles, E., Berno, A., Brennan, T., Carpenter, J., Chen, E., Cherry, J. M., Chung, E., Duncan, M., Guzman, E., Hartzell, G., Hunicke-Smith, S., Hyman, R. W., Kayser, A., Komp, C., Lashkari, D., Lew, H., Lin, D., Mosedale, D., Davis, R. W., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome V." Nature 387:78-81.9169868