You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameCytochrome c oxidase polypeptide 5B, mitochondrial
Synonyms
  • Cytochrome c oxidase polypeptide Vb
Gene NameCOX5B
Enzyme Class
Biological Properties
General FunctionInvolved in cytochrome-c oxidase activity
Specific Function4 ferrocytochrome c + O(2) + 4 H(+) = 4 ferricytochrome c + 2 H(2)O
Cellular LocationMitochondrion inner membrane
SMPDB Pathways
Oxidative phosphorylationPW002461 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Oxidative phosphorylationec00190 Map00190
SMPDB ReactionsNot Available
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB00862hydronShow
GO Classification
Component
Not Available
Function
oxidoreductase activity
heme-copper terminal oxidase activity
cytochrome-c oxidase activity
catalytic activity
Process
Not Available
Gene Properties
Chromosome Locationchromosome 9
LocusYIL111W
Gene Sequence>455 bp TGTTGCGTACTTCTCTTACTAAAGGGGCACGGCTAACTGGGACAAGATTTGTTCAAACAA AGGCCCTTTCGAAGGCAACATTGACAGATCTGCCCGAAAGATGGGAAAATATGCCAAACT TAGAACAGAAAGAGATTGCAGATAATTTGACAGAACGTCAAAAGCTTCCATGGAAAACTC TCAATAACGAGGAAATCAAAGCAGCTTGGTACATATCCTACGGCGAGTGGGGACCTAGAA GACCTGTACACGGAAAAGGCGATGTTGCATTTATAACTAAAGGAGTATTTTTAGGGTTAG GAATCTCATTTGGGCTCTTTGGTTTAGTGAGACTATTAGCCAATCCTGAAACTCCAAAGA CTATGAACAGGGAATGGCAGTTGAAATCAGACGAGTATCTGAAGTCAAAAAATGCCAATC CTTGGGGAGGTTATTCTCAAGTTCAATCTAAATAA
Protein Properties
Pfam Domain Function
Protein Residues151
Protein Molecular Weight17196.59961
Protein Theoretical pI10.43
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Cytochrome c oxidase polypeptide 5B, mitochondrial MLRTSLTKGARLTGTRFVQTKALSKATLTDLPERWENMPNLEQKEIADNLTERQKLPWKT LNNEEIKAAWYISYGEWGPRRPVHGKGDVAFITKGVFLGLGISFGLFGLVRLLANPETPK TMNREWQLKSDEYLKSKNANPWGGYSQVQSK
References
External Links
ResourceLink
Saccharomyces Genome Database COX5B
Uniprot IDP00425
Uniprot NameCOX5B_YEAST
GenBank Gene IDM17799
Genebank Protein ID171293
General Reference
  • Cumsky, M. G., Trueblood, C. E., Ko, C., Poyton, R. O. (1987). "Structural analysis of two genes encoding divergent forms of yeast cytochrome c oxidase subunit V." Mol Cell Biol 7:3511-3519.2824989
  • Churcher, C., Bowman, S., Badcock, K., Bankier, A., Brown, D., Chillingworth, T., Connor, R., Devlin, K., Gentles, S., Hamlin, N., Harris, D., Horsnell, T., Hunt, S., Jagels, K., Jones, M., Lye, G., Moule, S., Odell, C., Pearson, D., Rajandream, M., Rice, P., Rowley, N., Skelton, J., Smith, V., Barrell, B., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome IX." Nature 387:84-87.9169870
  • Hodge, M. R., Cumsky, M. G. (1989). "Splicing of a yeast intron containing an unusual 5' junction sequence." Mol Cell Biol 9:2765-2770.2548089
  • Cumsky, M. G., Ko, C., Trueblood, C. E., Poyton, R. O. (1985). "Two nonidentical forms of subunit V are functional in yeast cytochrome c oxidase." Proc Natl Acad Sci U S A 82:2235-2239.2986105
  • Geier, B. M., Schagger, H., Ortwein, C., Link, T. A., Hagen, W. R., Brandt, U., Von Jagow, G. (1995). "Kinetic properties and ligand binding of the eleven-subunit cytochrome-c oxidase from Saccharomyces cerevisiae isolated with a novel large-scale purification method." Eur J Biochem 227:296-302.7851399
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106