You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameCytochrome c oxidase subunit 3
Synonyms
  • Cytochrome c oxidase polypeptide III
Gene NameCOX3
Enzyme Class
Biological Properties
General FunctionInvolved in cytochrome-c oxidase activity
Specific FunctionSubunits I, II and III form the functional core of the enzyme complex
Cellular LocationMitochondrion inner membrane; Multi-pass membrane protein
SMPDB Pathways
Oxidative phosphorylationPW002461 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Oxidative phosphorylationec00190 Map00190
SMPDB ReactionsNot Available
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB00862hydronShow
GO Classification
Component
cell part
membrane
Function
catalytic activity
oxidoreductase activity
heme-copper terminal oxidase activity
cytochrome-c oxidase activity
Process
respiratory electron transport chain
mitochondrial electron transport, cytochrome c to oxygen
metabolic process
cellular metabolic process
generation of precursor metabolites and energy
electron transport chain
Gene Properties
Chromosome Locationchromosome 17
LocusQ0275
Gene Sequence>810 bp ATGACACATTTAGAAAGAAGTAGACATCAACAACATCCATTTCATATGGTTATGCCTTCA CCATGACCTATTGTAGTATCATTTGCATTATTATCATTAGCATTATCACTAGCATTAACA ATGCATGGTTATATTGGTAATATGAATATGGTATATTTAGCATTATTTGTATTATTAACA AGTTCTATTTTATGATTTAGAGATATTGTAGCTGAAGCTACATATTTAGGTGATCATACT ATAGCAGTAAGAAAAGGTATTAATTTAGGTTTCTTAATGTTTGTATTATCTGAAGTATTA ATCTTTGCTGGTTTATTCTGAGCTTATTTCCATTCAGCTATGAGTCCTGATGTACTATTA GGTGCATGTTGACCACCCGTAGGTATTGAAGCTGTACAACCTACCGAATTACCTTTATTA AATACTATTATCTTATTATCTTCTGGTGCTACTGTAACTTATAGTCATCATGCCTTAATC GCAGGTAATAGAAATAAAGCCTTATCAGGTTTATTAATTACATTCTGATTAATTGTTATT TTTGTTACTTGTCAATATATTGAATATACTAATGCTGCATTCACTATCTCTGATGGTGTT TATGGTTCAGTATTCTATGCTGGTACAGGATTACATTTCTTACATATGGTAATGTTAGCA GCTATGTTAGGTGTTAATTATTGAAGAATGAGAAATTATCATTTAACAGCTGGACATCAT GTTGGATATGAAACAACTATTATTTATCTACATGTTTTAGATGTTATCTGATTATTTTTA TACGTAGTCTTCTACTGATGAGGAGTCTAA
Protein Properties
Pfam Domain Function
Protein Residues269
Protein Molecular Weight30359.5
Protein Theoretical pI7.08
Signalling Regions
  • None
Transmembrane Regions
  • 16-36
  • 45-65
  • 90-110
  • 142-162
  • 167-187
  • 204-224
  • 247-267
Protein Sequence>Cytochrome c oxidase subunit 3 MTHLERSRHQQHPFHMVMPSPWPIVVSFALLSLALSTALTMHGYIGNMNMVYLALFVLLT SSILWFRDIVAEATYLGDHTMAVRKGINLGFLMFVLSEVLIFAGLFWAYFHSAMSPDVTL GACWPPVGIEAVQPTELPLLNTIILLSSGATVTYSHHALIAGNRNKALSGLLITFWLIVI FVTCQYIEYTNAAFTISDGVYGSVFYAGTGLHFLHMVMLAAMLGVNYWRMRNYHLTAGHH VGYETTIIYTHVLDVIWLFLYVVFYWWGV
References
External Links
ResourceLink
Saccharomyces Genome Database COX3
Uniprot IDP00420
Uniprot NameCOX3_YEAST
GenBank Gene IDAJ011856
Genebank Protein ID4160389
General Reference
  • Thalenfeld, B. E., Tzagoloff, A. (1980). "Assembly of the mitochondrial membrane system. Sequence of the oxi 2 gene of yeast mitochondrial DNA." J Biol Chem 255:6173-6180.6248512
  • de Zamaroczy, M., Bernardi, G. (1986). "The primary structure of the mitochondrial genome of Saccharomyces cerevisiae--a review." Gene 47:155-177.3549452
  • Foury, F., Roganti, T., Lecrenier, N., Purnelle, B. (1998). "The complete sequence of the mitochondrial genome of Saccharomyces cerevisiae." FEBS Lett 440:325-331.9872396
  • Geier, B. M., Schagger, H., Ortwein, C., Link, T. A., Hagen, W. R., Brandt, U., Von Jagow, G. (1995). "Kinetic properties and ligand binding of the eleven-subunit cytochrome-c oxidase from Saccharomyces cerevisiae isolated with a novel large-scale purification method." Eur J Biochem 227:296-302.7851399