You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameCytochrome c oxidase subunit 1
Synonyms
  • Cytochrome c oxidase polypeptide I
Gene NameCOX1
Enzyme Class
Biological Properties
General FunctionInvolved in iron ion binding
Specific FunctionCytochrome c oxidase is the component of the respiratory chain that catalyzes the reduction of oxygen to water. Subunits 1- 3 form the functional core of the enzyme complex. CO I is the catalytic subunit of the enzyme. Electrons originating in cytochrome c are transferred via the copper A center of subunit 2 and heme A of subunit 1 to the bimetallic center formed by heme A3 and copper B
Cellular LocationMitochondrion inner membrane; Multi-pass membrane protein
SMPDB Pathways
Oxidative phosphorylationPW002461 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Oxidative phosphorylationec00190 Map00190
SMPDB ReactionsNot Available
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB00862hydronShow
GO Classification
Component
cell part
membrane part
intrinsic to membrane
integral to membrane
Function
binding
ion binding
cation binding
metal ion binding
transition metal ion binding
iron ion binding
heme binding
electron carrier activity
Process
cellular metabolic process
cellular respiration
aerobic respiration
metabolic process
generation of precursor metabolites and energy
energy derivation by oxidation of organic compounds
Gene Properties
Chromosome Locationchromosome 17
LocusQ0045
Gene Sequence>1605 bp ATGGTACAAAGATGATTATATTCAACAAATGCAAAAGATATTGCAGTATTATATTTTATG TTAGCTATTTTTAGTGGTATGGCAGGAACAGCAATGTCTTTAATCATTAGATTAGAATTA GCTGCACCTGGTTCACAATATTTACATGGTAATTCACAATTATTTAATGTTTTAGTAGTT GGTCATGCTGTATTAATGATTTTCTTCTTAGTAATGCCTGCTTTAATTGGAGGTTTTGGT AACTATTTATTACCATTAATAATTGGAGCTACAGATACAGCATTTCCAAGAATTAATAAC ATTGCTTTTTGAGTATTACCTATGGGGTTAGTATGTTTAGTTACATCAACTTTAGTAGAA TCAGGTGCTGGTACAGGGTGAACTGTCTATCCACCATTATCATCTATTCAGGCACATTCA GGACCTAGTGTAGATTTAGCAATTTTTGCATTACATTTAACATCAATTTCATCATTATTA GGTGCTATTAATTTCATTGTAACAACATTAAATATGAGAACAAATGGTATGACAATGCAT AAATTACCATTATTTGTATGATCAATTTTCATTACAGCGTTCTTATTATTATTATCATTA CCTGTATTATCTGCTGGTATTACAATGTTATTATTAGATAGAAACTTCAATACTTCATTC TTTGAAGTATCAGGAGGTGGTGACCCAATCTTATACGAGCATTTATTTTGATTCTTTGGT CACCCTGAAGTATATATTTTAATTATTCCTGGATTTGGTATTATTTCACATGTAGTATCA ACATATTCTAAAAAACCTGTATTTGGTGAAATTTCAATGGTATATGCTATGGCTTCAATT GGATTATTAGGATTCTTAGTATGATCACATCATATGTATATTGTAGGATTAGATGCAGAT CTTAGAGCATATTTCCTATCTGCACTAATGATTATTGCAATTCCAACAGGAATTAAAATT TTCTCATGATTAGCTCTAATCCATGGTGGTTCAATTAGATTAGCACTACCTATGTTATAT GCAATTGCATTCTTATTCTTATTCACAATGGGTGGTTTAACTGGTGTTGCCTTAGCTAAC GCCTCATTAGATGTAGCATTCCACGATACTTACTACGTGGTGGGACATTTTCACTATGTA TTATCAATGGGTGCTATTTTCTCTTTATTTGCAGGATACTATTATTGAAGTCCTCAAATT TTAGGTTTAAACTATAATGAAAAATTAGCTCAAATTCAATTCTGATTAATTTTCATTGGG GCTAATGTTATTTTCTTCCCAATGCATTTTTTAGGTATTAATGGTATGCCTAGAAGAATT CCTGATTATCCTGATGCTTTCGCAGGATGAAATTATGTCGCTTCTATTGGTTCATTCATT GCACTATTATCATTATTCTTATTTATCTATATTTTATATGATCAATTAGTTAATGGATTA AACAATAAAGTTAATAATAAATCAGTTATTTATAATAAAGCACCTGATTTTGTAGAATCT AATCTTATCTTTAATTTAAATACAGTTAAATCTTCATCTATCGAATTCTTATTAACTTCT CCACCAGCTGTACACTCATTTAATACACCAGCTGTACAATCTTAA
Protein Properties
Pfam Domain Function
Protein Residues534
Protein Molecular Weight58797.5
Protein Theoretical pI7.12
Signalling Regions
  • None
Transmembrane Regions
  • 16-38
  • 58-80
  • 101-123
  • 148-170
  • 183-205
  • 237-259
  • 266-288
  • 303-325
  • 337-359
  • 374-396
  • 409-431
  • 451-473
Protein Sequence>Cytochrome c oxidase subunit 1 MVQRWLYSTNAKDIAVLYFMLAIFSGMAGTAMSLIIRLELAAPGSQYLHGNSQLFNVLVV GHAVLMIFFLVMPALIGGFGNYLLPLMIGATDTAFPRINNIAFWVLPMGLVCLVTSTLVE SGAGTGWTVYPPLSSIQAHSGPSVDLAIFALHLTSISSLLGAINFIVTTLNMRTNGMTMH KLPLFVWSIFITAFLLLLSLPVLSAGITMLLLDRNFNTSFFEVSGGGDPILYEHLFWFFG HPEVYILIIPGFGIISHVVSTYSKKPVFGEISMVYAMASIGLLGFLVWSHHMYIVGLDAD TRAYFTSATMIIAIPTGIKIFSWLATIHGGSIRLATPMLYAIAFLFLFTMGGLTGVALAN ASLDVAFHDTYYVVGHFHYVLSMGAIFSLFAGYYYWSPQILGLNYNEKLAQIQFWLIFIG ANVIFFPMHFLGINGMPRRIPDYPDAFAGWNYVASIGSFIATLSLFLFIYILYDQLVNGL NNKVNNKSVIYNKAPDFVESNTIFNLNTVKSSSIEFLLTSPPAVHSFNTPAVQS
References
External Links
ResourceLink
Saccharomyces Genome Database COX1
Uniprot IDP00401
Uniprot NameCOX1_YEAST
GenBank Gene IDAJ011856
Genebank Protein ID4160366
General Reference
  • Bonitz, S. G., Coruzzi, G., Thalenfeld, B. E., Tzagoloff, A., Macino, G. (1980). "Assembly of the mitochondrial membrane system. Structure and nucleotide sequence of the gene coding for subunit 1 of yeast cytochrme oxidase." J Biol Chem 255:11927-11941.6254986
  • Foury, F., Roganti, T., Lecrenier, N., Purnelle, B. (1998). "The complete sequence of the mitochondrial genome of Saccharomyces cerevisiae." FEBS Lett 440:325-331.9872396
  • Seraphin, B., Simon, M., Jacq, C., Faye, G. (1989). "Sequence of the yeast mitochondrial OX13/OL12 promoter region." Nucleic Acids Res 17:4886.2664712
  • Geier, B. M., Schagger, H., Ortwein, C., Link, T. A., Hagen, W. R., Brandt, U., Von Jagow, G. (1995). "Kinetic properties and ligand binding of the eleven-subunit cytochrome-c oxidase from Saccharomyces cerevisiae isolated with a novel large-scale purification method." Eur J Biochem 227:296-302.7851399