You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameCytochrome b
Synonyms
  • Complex III subunit 3
  • Complex III subunit CYTB
  • Complex III subunit III
  • Cytochrome b-c1 complex subunit 3
  • Cytochrome b-c1 complex subunit CYTB
  • Ubiquinol-cytochrome-c reductase complex cytochrome b subunit
Gene NameCOB
Enzyme ClassNot Available
Biological Properties
General FunctionEnergy production and conversion
Specific FunctionComponent of the ubiquinol-cytochrome c reductase complex (complex III or cytochrome b-c1 complex), which is part of the mitochondrial respiratory chain that generates an electrochemical potential coupled to ATP synthesis. The complex couples electron transfer from ubiquinol to cytochrome c
Cellular LocationMitochondrion inner membrane; Multi-pass membrane protein
SMPDB PathwaysNot Available
KEGG PathwaysNot Available
SMPDB ReactionsNot Available
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
GO Classification
Component
cell part
membrane
Function
electron carrier activity
catalytic activity
oxidoreductase activity
Process
generation of precursor metabolites and energy
electron transport chain
respiratory electron transport chain
metabolic process
cellular metabolic process
Gene Properties
Chromosome LocationNot Available
Locus
Gene Sequence>1158 bp ATGGCATTTAGAAAATCAAATGTGTATTTAAGTTTAGTGAATAGTTATATTATTGATTCA CCACAACCATCATCAATTAATTATTGATGAAATATGGGTTCATTATTAGGTTTATGTTTA GTTATTCAAATTGTAACAGGTATTTTTATGGCTATGCATTATTCATCTAATATTGAATTA GCTTTTTCATCTGTTGAACATATTATAAGAGATGTGCATAATGGTTATATTTTAAGATAT TTACATGCAAATGGTGCATCATTCTTTTTTATGGTAATGTTTATGCATATGGCTAAAGGT TTATATTATGGTTCATATAGATCACCAAGAGTACTATTATGAAATGTAGGTGTTATTATT TTCATTTTAACTATTGCTACAGCTTTTTTAGGTTATTGTTGTGTTTATGGACAGATGTCA CATTGAGGTGCACTAGTTATTACTAATTTATTCTCAGCAATTCCATTTGTAGGTAACGAT ATTGTATCTTGATTATGAGGTGGGTTCTCAGTATCTAACCCTCTAATCCAGAGATTCTTT GCGTTACATTATTTAGTACCTTTTATCATTGCTGCAATGGTTATTATGCATTTAATGGCA TTACATATTCATGGTTCATCTAATCCATTAGGTATTACAGGTAATTTAGATAGAATTCCA ATGCATTCATACTTTATTTTTAAAGATTTAGTAACTGTTTTCTTATTTATGTTAATTTTA GCATTATTTGTATTCTATTCACCTAATACTTTAGGTCATCCTGATAACTATATTCCTGGT AATCCTTTAGTAACACCAGCATCTATTGTACCTGAATGATACTTATTACCATTCTATGCT ATTTTAAGATCTATTCCTGATAAATTATTAGGAGTTATTCTAATGTTTGCAGCTATTTTA GTATTATTAGTTTTACCATTTACTGATAGAAGTGTAGTAAGAGGTAATACTTTTAAAGTA TTATCTAAATTCTTCTTCTTTATCTTTGTATTCAATTTCGTATTATTAGGACAAATTGGA GCATGCCATGTAGAAGTACCTTATGTCTTAATGGGACAAATCGCTACATTTATCTACTTC GCTTATTTCTTAATTATTGTACCTGTTATCTCTACTATTGAAAATGTTTTATTCTATATC GGTAGAGTTAATAAATAA
Protein Properties
Pfam Domain Function
Protein Residues385
Protein Molecular Weight43655.5
Protein Theoretical pI8.93
PDB Fileshow
Signalling Regions
  • None
Transmembrane Regions
  • 32-52
  • 85-105
  • 116-136
  • 151-171
  • 179-199
  • 225-245
  • 289-309
  • 324-344
  • 350-370
Protein Sequence>Cytochrome b MAFRKSNVYLSLVNSYIIDSPQPSSINYWWNMGSLLGLCLVIQIVTGIFMAMHYSSNIEL AFSSVEHIMRDVHNGYILRYLHANGASFFFMVMFMHMAKGLYYGSYRSPRVTLWNVGVII FILTIATAFLGYCCVYGQMSHWGATVITNLFSAIPFVGNDIVSWLWGGFSVSNPTIQRFF ALHYLVPFIIAAMVIMHLMALHIHGSSNPLGITGNLDRIPMHSYFIFKDLVTVFLFMLIL ALFVFYSPNTLGHPDNYIPGNPLVTPASIVPEWYLLPFYAILRSIPDKLLGVITMFAAIL VLLVLPFTDRSVVRGNTFKVLSKFFFFIFVFNFVLLGQIGACHVEVPYVLMGQIATFIYF AYFLIIVPVISTIENVLFYIGRVNK
References
External Links
ResourceLink
Saccharomyces Genome Database COB
Uniprot IDP00163
Uniprot NameCYB_YEAST
GenBank Gene IDAJ011856
Genebank Protein ID4160376
PDB ID
1P84
General Reference
  • Nobrega, F. G., Tzagoloff, A. (1980). "Assembly of the mitochondrial membrane system. DNA sequence and organization of the cytochrome b gene in Saccharomyces cerevisiae D273-10B." J Biol Chem 255:9828-9837.6253454
  • Bonjardim, C. A., Nobrega, F. G. (1984). "Revision of the nucleotide sequence at the last intron of the mitochondrial apocytochrome b gene in Saccharomyces cerevisiae." Braz J Med Biol Res 17:17-20.6383504
  • Claros, M. G., Perea, J., Shu, Y., Samatey, F. A., Popot, J. L., Jacq, C. (1995). "Limitations to in vivo import of hydrophobic proteins into yeast mitochondria. The case of a cytoplasmically synthesized apocytochrome b." Eur J Biochem 228:762-771.7737175
  • Foury, F., Roganti, T., Lecrenier, N., Purnelle, B. (1998). "The complete sequence of the mitochondrial genome of Saccharomyces cerevisiae." FEBS Lett 440:325-331.9872396
  • Lazowska, J., Jacq, C., Slonimski, P. P. (1980). "Sequence of introns and flanking exons in wild-type and box3 mutants of cytochrome b reveals an interlaced splicing protein coded by an intron." Cell 22:333-348.7004642
  • Lazowska, J., Jacq, C., Slonimski, P. P. (1981). "Splice points of the third intron in the yeast mitochondrial cytochrome b gene." Cell 27:12-14.7034963
  • Brivet-Chevillotte, P., di Rago, J. P. (1989). "Electron-transfer restoration by vitamin K3 in a complex III-deficient mutant of S. cerevisiae and sequence of the corresponding cytochrome b mutation." FEBS Lett 255:5-9.2551731
  • Hunte, C., Koepke, J., Lange, C., Rossmanith, T., Michel, H. (2000). "Structure at 2.3 A resolution of the cytochrome bc(1) complex from the yeast Saccharomyces cerevisiae co-crystallized with an antibody Fv fragment." Structure 8:669-684.10873857
  • Lange, C., Hunte, C. (2002). "Crystal structure of the yeast cytochrome bc1 complex with its bound substrate cytochrome c." Proc Natl Acad Sci U S A 99:2800-2805.11880631