You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameCytochrome b-c1 complex subunit 7
Synonyms
  • Complex III subunit 7
  • Complex III subunit VII
  • Ubiquinol-cytochrome c reductase c reductase complex 14 kDa protein
Gene NameQCR7
Enzyme ClassNot Available
Biological Properties
General FunctionInvolved in protein binding
Specific FunctionComponent of the ubiquinol-cytochrome c reductase complex (complex III or cytochrome b-c1 complex), which is part of the mitochondrial respiratory chain that generates an electrochemical potential coupled to ATP synthesis. The complex couples electron transfer from ubiquinol to cytochrome c. QCR7 is involved in redox-linked proton pumping
Cellular LocationMitochondrion inner membrane
SMPDB PathwaysNot Available
KEGG PathwaysNot Available
SMPDB ReactionsNot Available
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
GO Classification
Function
ion transmembrane transporter activity
cation transmembrane transporter activity
inorganic cation transmembrane transporter activity
monovalent inorganic cation transmembrane transporter activity
hydrogen ion transmembrane transporter activity
ubiquinol-cytochrome-c reductase activity
transporter activity
transmembrane transporter activity
substrate-specific transmembrane transporter activity
Process
metabolic process
generation of precursor metabolites and energy
cellular metabolic process
electron transport chain
respiratory electron transport chain
mitochondrial electron transport, ubiquinol to cytochrome c
Gene Properties
Chromosome LocationNot Available
Locus
Gene Sequence>384 bp ATGCCACAGTCTTTTACGTCTATTGCGAGAATTGGTGACTATATTTTGAAGTCACCCGTC CTCTCCAAGTTATGTGTTCCAGTTGCCAATCAGTTCATTAACCTCGCAGGTTACAAGAAG TTAGGGCTCAAATTTGACGACTTAATTGCAGAGGAAAATCCCATCATGCAGACCGCTTTA AGAAGACTCCCTGAAGATGAATCTTATGCCAGAGCATATAGAATAATCAGGGCTCATCAA ACCGAGTTGACTCATCATTTACTGCCAAGAAACGAATGGATCAAAGCCCAAGAGGATGTT CCTTACCTGTTGCCATACATATTAGAAGCTGAAGCTGCAGCTAAGGAGAAGGACGAGTTA GACAACATAGAGGTCTCCAAATGA
Protein Properties
Pfam Domain Function
Protein Residues127
Protein Molecular Weight14564.59961
Protein Theoretical pI5.7
PDB Fileshow
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Cytochrome b-c1 complex subunit 7 MPQSFTSIARIGDYILKSPVLSKLCVPVANQFINLAGYKKLGLKFDDLIAEENPIMQTAL RRLPEDESYARAYRIIRAHQTELTHHLLPRNEWIKAQEDVPYLLPYILEAEAAAKEKDEL DNIEVSK
References
External Links
ResourceLink
Saccharomyces Genome Database QCR7
Uniprot IDP00128
Uniprot NameQCR7_YEAST
GenBank Gene IDU33057
Genebank Protein ID927796
PDB ID
1KYO
General Reference
  • De Haan, M., van Loon, A. P., Kreike, J., Vaessen, R. T., Grivell, L. A. (1984). "The biosynthesis of the ubiquinol-cytochrome c reductase complex in yeast. DNA sequence analysis of the nuclear gene coding for the 14-kDa subunit." Eur J Biochem 138:169-177.6319130
  • Jacq, C., Alt-Morbe, J., Andre, B., Arnold, W., Bahr, A., Ballesta, J. P., Bargues, M., Baron, L., Becker, A., Biteau, N., Blocker, H., Blugeon, C., Boskovic, J., Brandt, P., Bruckner, M., Buitrago, M. J., Coster, F., Delaveau, T., del Rey, F., Dujon, B., Eide, L. G., Garcia-Cantalejo, J. M., Goffeau, A., Gomez-Peris, A., Zaccaria, P., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome IV." Nature 387:75-78.9169867
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Hunte, C., Koepke, J., Lange, C., Rossmanith, T., Michel, H. (2000). "Structure at 2.3 A resolution of the cytochrome bc(1) complex from the yeast Saccharomyces cerevisiae co-crystallized with an antibody Fv fragment." Structure 8:669-684.10873857
  • Lange, C., Hunte, C. (2002). "Crystal structure of the yeast cytochrome bc1 complex with its bound substrate cytochrome c." Proc Natl Acad Sci U S A 99:2800-2805.11880631
  • Palsdottir, H., Lojero, C. G., Trumpower, B. L., Hunte, C. (2003). "Structure of the yeast cytochrome bc1 complex with a hydroxyquinone anion Qo site inhibitor bound." J Biol Chem 278:31303-31311.12782631