You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameCytochrome c iso-2
SynonymsNot Available
Gene NameCYC7
Enzyme ClassNot Available
Biological Properties
General FunctionInvolved in iron ion binding
Specific FunctionElectron carrier protein. The oxidized form of the cytochrome c heme group can accept an electron from the heme group of the cytochrome c1 subunit of cytochrome reductase. Cytochrome c then transfers this electron to the cytochrome oxidase complex, the final protein carrier in the mitochondrial electron-transport chain
Cellular LocationMitochondrion intermembrane space
SMPDB Pathways
Sulfur metabolismPW002483 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Sulfur metabolismec00920 Map00920
SMPDB Reactions
ThiosulfateSulfate
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB00005SulfateShow
YMDB00175Pyruvic acidShow
YMDB00247L-Lactic acidShow
YMDB00287D-Lactic acidShow
YMDB00303ThiosulfateShow
YMDB00660Ubiquinone-6Show
YMDB00862hydronShow
YMDB00888Hydrogen peroxideShow
YMDB00890waterShow
YMDB00900oxygenShow
YMDB00915Ubiquinol-6Show
GO Classification
Component
Not Available
Function
electron carrier activity
binding
ion binding
cation binding
metal ion binding
transition metal ion binding
iron ion binding
heme binding
Process
Not Available
Gene Properties
Chromosome Locationchromosome 5
LocusYEL039C
Gene Sequence>342 bp ATGGCTAAAGAAAGTACGGGATTCAAACCAGGCTCTGCAAAAAAGGGTGCTACATTGTTT AAAACGAGGTGTCAGCAGTGTCATACAATAGAAGAGGGTGGTCCTAACAAAGTTGGACCT AATTTACATGGTATTTTTGGTAGACATTCAGGTCAGGTAAAGGGTTATTCTTACACAGAT GCAAACATCAACAAGAACGTCAAATGGGATGAGGATAGTATGTCCGAGTACTTGACGAAC CCAAAGAAATATATTCCTGGTACCAAGATGGCGTTTGCCGGGTTGAAGAAGGAAAAGGAC AGAAACGATTTAATTACTTATATGACAAAGGCTGCCAAATAG
Protein Properties
Pfam Domain Function
Protein Residues113
Protein Molecular Weight12532.2998
Protein Theoretical pI10.18
PDB Fileshow
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Cytochrome c iso-2 MAKESTGFKPGSAKKGATLFKTRCQQCHTIEEGGPNKVGPNLHGIFGRHSGQVKGYSYTD ANINKNVKWDEDSMSEYLTNPKKYIPGTKMAFAGLKKEKDRNDLITYMTKAAK
References
External Links
ResourceLink
Saccharomyces Genome Database CYC7
Uniprot IDP00045
Uniprot NameCYC7_YEAST
GenBank Gene IDAY693032
Genebank Protein ID51013515
PDB ID
1YEA
General Reference
  • Montgomery, D. L., Leung, D. W., Smith, M., Shalit, P., Faye, G., Hall, B. D. (1980). "Isolation and sequence of the gene for iso-2-cytochrome c in Saccharomyces cerevisiae." Proc Natl Acad Sci U S A 77:541-545.6244566
  • Melnick, L., Sherman, F. (1993). "The gene clusters ARC and COR on chromosomes 5 and 10, respectively, of Saccharomyces cerevisiae share a common ancestry." J Mol Biol 233:372-388.8411151
  • Dietrich, F. S., Mulligan, J., Hennessy, K., Yelton, M. A., Allen, E., Araujo, R., Aviles, E., Berno, A., Brennan, T., Carpenter, J., Chen, E., Cherry, J. M., Chung, E., Duncan, M., Guzman, E., Hartzell, G., Hunicke-Smith, S., Hyman, R. W., Kayser, A., Komp, C., Lashkari, D., Lew, H., Lin, D., Mosedale, D., Davis, R. W., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome V." Nature 387:78-81.9169868
  • Hu, Y., Rolfs, A., Bhullar, B., Murthy, T. V., Zhu, C., Berger, M. F., Camargo, A. A., Kelley, F., McCarron, S., Jepson, D., Richardson, A., Raphael, J., Moreira, D., Taycher, E., Zuo, D., Mohr, S., Kane, M. F., Williamson, J., Simpson, A., Bulyk, M. L., Harlow, E., Marsischky, G., Kolodner, R. D., LaBaer, J. (2007). "Approaching a complete repository of sequence-verified protein-encoding clones for Saccharomyces cerevisiae." Genome Res 17:536-543.17322287
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Murphy, M. E., Nall, B. T., Brayer, G. D. (1992). "Structure determination and analysis of yeast iso-2-cytochrome c and a composite mutant protein." J Mol Biol 227:160-176.1326054