Canmetcon
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameMitochondrial distribution and morphology protein 35
SynonymsNot Available
Gene NameMDM35
Enzyme ClassNot Available
Biological Properties
General Functionprotein targeting to mitochondrion
Specific FunctionInvolved in mitochondrial distribution and morphology. Mediates the import of UPS1, UPS2 and UPS3, 3 atypical mitochondrial intermembrane space (IMS) proteins lacking the two major IMS-targeting signals, into the intermembrane space. The UPS1:MDM35 complex mediates the transfer of phosphatidic acid (PA) between liposomes and probably functions as a PA transporter across the mitochondrion intermembrane space (PubMed:26071602, PubMed:26071601, PubMed:26235513). Phosphatidic acid import is required for cardiolipin (CL) synthesis in the mitochondrial inner membrane (PubMed:26071602).
Cellular LocationNot Available
SMPDB Pathways
Cardiolipin BiosynthesisPW002431 ThumbThumb?image type=greyscaleThumb?image type=simple
Cardiolipin Biosynthesis CL(10:0/10:0/10:0/28:0)PW003484 ThumbThumb?image type=greyscaleThumb?image type=simple
Cardiolipin Biosynthesis CL(10:0/10:0/10:0/30:0)PW003501 ThumbThumb?image type=greyscaleThumb?image type=simple
Cardiolipin Biosynthesis CL(10:0/10:0/12:0/26:0)PW003502 ThumbThumb?image type=greyscaleThumb?image type=simple
Cardiolipin Biosynthesis CL(10:0/10:0/12:0/28:0)PW003503 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG PathwaysNot Available
SMPDB ReactionsNot Available
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
GO Classification
Function
mitochondrial intermembrane space
nucleus
lipid transport
mitochondrial respiratory chain complex assembly
mitochondrion organization
protein targeting to mitochondrion
Gene Properties
Chromosome LocationNot Available
Locus
Gene Sequence>261 bp ATGGGGAATATAATGTCAGCTAGTTTTGCGCCTGAATGCACTGACCTGAAGACGAAATAC GATAGTTGTTTTAATGAATGGTATAGCGAAAAATTCCTGAAGGGAAAATCCGTTGAGAAC GAGTGCTCAAAACAATGGTACGCTTATACTACATGTGTCAACGCAGCTCTCGTCAAACAA GGTATTAAGCCTGCTCTAGACGAAGCTAGGGAGGAGGCGCCGTTTGAAAATGGCGGCAAA CTAAAAGAAGTTGACAAATGA
Protein Properties
Pfam Domain FunctionNot Available
Protein Residues86
Protein Molecular Weight9711.885
Protein Theoretical pINot Available
PDB Fileshow
Signalling RegionsNot Available
Transmembrane RegionsNot Available
Protein Sequence>Mitochondrial distribution and morphology protein 35 MGNIMSASFAPECTDLKTKYDSCFNEWYSEKFLKGKSVENECSKQWYAYTTCVNAALVKQ GIKPALDEAREEAPFENGGKLKEVDK
References
External Links
ResourceLink
Saccharomyces Genome Database MDM35
Uniprot IDO60200
Uniprot NameMDM35
PDB ID
4XHR
General ReferenceNot Available