You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NamePheromone alpha factor receptor
SynonymsNot Available
Gene NameSTE2
Enzyme ClassNot Available
Biological Properties
General Functionreceptor transactivation
Specific FunctionReceptor for the peptide pheromone alpha factor, the mating factor of yeast.
Cellular LocationNot Available
SMPDB Pathways
Stress-activated signalling pathways: pheromone stress test 1PW012843 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG PathwaysNot Available
SMPDB ReactionsNot Available
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
GO Classification
Function
receptor transactivation
G-protein coupled receptor homodimeric complex
integral component of plasma membrane
mating-type alpha-factor pheromone receptor activity
pheromone binding
cell projection assembly
cytogamy
pheromone-dependent signal transduction involved in conjugation with cellular fusion
positive regulation of conjugation with cellular fusion
protein homooligomerization
Gene Properties
Chromosome LocationNot Available
Locus
Gene Sequence>1296 bp ATGTCTGATGCGGCTCCTTCATTGAGCAATCTATTTTATGATCCAACGTATAATCCTGGT CAAAGCACCATTAACTACACTTCCATATATGGGAATGGATCTACCATCACTTTCGATGAG TTGCAAGGTTTAGTTAACAGTACTGTTACTCAGGCCATTATGTTTGGTGTCAGATGTGGT GCAGCTGCTTTGACTTTGATTGTCATGTGGATGACATCGAGAAGCAGAAAAACGCCGATT TTCATTATCAACCAAGTTTCATTGTTTTTAATCATTTTGCATTCTGCACTCTATTTTAAA TATTTACTGTCTAATTACTCTTCAGTGACTTACGCTCTCACCGGATTTCCTCAGTTCATC AGTAGAGGTGACGTTCATGTTTATGGTGCTACAAATATAATTCAAGTCCTTCTTGTGGCT TCTATTGAGACTTCACTGGTGTTTCAGATAAAAGTTATTTTCACAGGCGACAACTTCAAA AGGATAGGTTTGATGCTGACGTCGATATCTTTCACTTTAGGGATTGCTACAGTTACCATG TATTTTGTAAGCGCTGTTAAAGGTATGATTGTGACTTATAATGATGTTAGTGCCACCCAA GATAAATACTTCAATGCATCCACAATTTTACTTGCATCCTCAATAAACTTTATGTCATTT GTCCTGGTAGTTAAATTGATTTTAGCTATTAGATCAAGAAGATTCCTTGGTCTCAAGCAG TTCGATAGTTTCCATATTTTACTCATAATGTCATGTCAATCTTTGTTGGTTCCATCGATA ATATTCATCCTCGCATACAGTTTGAAACCAAACCAGGGAACAGATGTCTTGACTACTGTT GCAACATTACTTGCTGTATTGTCTTTACCATTATCATCAATGTGGGCCACGGCTGCTAAT AATGCATCCAAAACAAACACAATTACTTCAGACTTTACAACATCCACAGATAGGTTTTAT CCAGGCACGCTGTCTAGCTTTCAAACTGATAGTATCAACAACGATGCTAAAAGCAGTCTC AGAAGTAGATTATATGACCTATATCCTAGAAGGAAGGAAACAACATCGGATAAACATTCG GAAAGAACTTTTGTTTCTGAGACTGCAGATGATATAGAGAAAAATCAGTTTTATCAGTTG CCCACACCTACGAGTTCAAAAAATACTAGGATAGGACCGTTTGCTGATGCAAGTTACAAA GAGGGAGAAGTTGAACCCGTCGACATGTACACTCCCGATACGGCAGCTGATGAGGAAGCC AGAAAGTTCTGGACTGAAGATAATAATAATTTATGA
Protein Properties
Pfam Domain FunctionNot Available
Protein Residues431
Protein Molecular Weight47848.14
Protein Theoretical pINot Available
PDB Fileshow
Signalling RegionsNot Available
Transmembrane Regions
  • 51-73
  • 80-102
  • 133-155
  • 162-184
  • 209-231
  • 244-266
  • 276-298
Protein Sequence>Pheromone alpha factor receptor MSDAAPSLSNLFYDPTYNPGQSTINYTSIYGNGSTITFDELQGLVNSTVTQAIMFGVRCG AAALTLIVMWMTSRSRKTPIFIINQVSLFLIILHSALYFKYLLSNYSSVTYALTGFPQFI SRGDVHVYGATNIIQVLLVASIETSLVFQIKVIFTGDNFKRIGLMLTSISFTLGIATVTM YFVSAVKGMIVTYNDVSATQDKYFNASTILLASSINFMSFVLVVKLILAIRSRRFLGLKQ FDSFHILLIMSCQSLLVPSIIFILAYSLKPNQGTDVLTTVATLLAVLSLPLSSMWATAAN NASKTNTITSDFTTSTDRFYPGTLSSFQTDSINNDAKSSLRSRLYDLYPRRKETTSDKHS ERTFVSETADDIEKNQFYQLPTPTSSKNTRIGPFADASYKEGEVEPVDMYTPDTAADEEA RKFWTEDNNNL
References
External Links
ResourceLink
Saccharomyces Genome Database STE2
Uniprot IDD6VTK4
Uniprot NameSTE2
PDB ID
1PJD
General ReferenceNot Available