You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification |
---|
Name | Ceramide synthase subunit LIP1 |
---|
Synonyms | Not Available |
---|
Gene Name | LIP1 |
---|
Enzyme Class | Not Available |
---|
Biological Properties |
---|
General Function | lipid metabolic process |
---|
Specific Function | Component of the ceramide synthase complex required for synthesis of ceramides. |
---|
Cellular Location | Not Available |
---|
SMPDB Pathways | Biosynthesis of unsaturated fatty acids | PW002403 |    | Biosynthesis of unsaturated fatty acids (docosanoyl) | PW002408 |    | Biosynthesis of unsaturated fatty acids (icosanoyl) | PW002434 |    | Biosynthesis of unsaturated fatty acids (stearoyl) | PW002435 |    | Biosynthesis of unsaturated fatty acids (tetracosanoyl-CoA) | PW002404 |    |
|
---|
KEGG Pathways | Biosynthesis of unsaturated fatty acids | ec01040 |  |
|
---|
SMPDB Reactions | |
---|
KEGG Reactions | Not Available |
---|
Metabolites | YMDB ID | Name | View |
---|
YMDB00045 | Coenzyme A | Show | YMDB00285 | Phytosphingosine | Show | YMDB00537 | hexacosanoyl-CoA | Show | YMDB00538 | stearoyl-CoA | Show | YMDB00862 | hydron | Show | YMDB00909 | Tetracosanoyl-CoA | Show | YMDB00963 | N-Tetracosanoylphytosphingosine | Show | YMDB01105 | Cer 18:0;3/22:0;0 | Show | YMDB16181 | Eicosanoyl-CoA | Show | YMDB16242 | Docosanoyl-CoA | Show | YMDB16301 | N-hexacosanoyl-C20-4-hydroxysphinganine | Show | YMDB16307 | N-stearoylphytosphingosine | Show | YMDB16308 | N-icosanoylphytosphingosine | Show |
|
---|
GO Classification | Function |
---|
integral component of membrane | endoplasmic reticulum membrane | lipid metabolic process |
|
---|
Gene Properties |
---|
Chromosome Location | Not Available |
---|
Locus | |
---|
Gene Sequence | Not Available |
---|
Protein Properties |
---|
Pfam Domain Function | Not Available |
---|
Protein Residues | Not Available |
---|
Protein Molecular Weight | 17206.535 |
---|
Protein Theoretical pI | Not Available |
---|
Signalling Regions | Not Available |
---|
Transmembrane Regions | |
---|
Protein Sequence | >Ceramide synthase subunit LIP1
MSQPTPIITTKSAAKPKPKIFNLFRVCFISLLLIAAVEYFKYGTRINYEWFHCTPIKEPQ
SGSVIKLWARGGPSCDKRGEYKTIVKRITRDYEPNDEHLSFCIIENDNVPPVHYPIHEDK
GEPGYVAYVGYDTDSELVQELCADSTIYHM |
---|
References |
---|
External Links | Resource | Link |
---|
Saccharomyces Genome Database | LIP1 | Uniprot ID | A6ZN14 | Uniprot Name | LIP1 |
|
---|
General Reference | Not Available |
---|