You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameCeramide synthase subunit LIP1
SynonymsNot Available
Gene NameLIP1
Enzyme ClassNot Available
Biological Properties
General Functionlipid metabolic process
Specific FunctionComponent of the ceramide synthase complex required for synthesis of ceramides.
Cellular LocationNot Available
SMPDB Pathways
Biosynthesis of unsaturated fatty acidsPW002403 ThumbThumb?image type=greyscaleThumb?image type=simple
Biosynthesis of unsaturated fatty acids (docosanoyl)PW002408 ThumbThumb?image type=greyscaleThumb?image type=simple
Biosynthesis of unsaturated fatty acids (icosanoyl)PW002434 ThumbThumb?image type=greyscaleThumb?image type=simple
Biosynthesis of unsaturated fatty acids (stearoyl)PW002435 ThumbThumb?image type=greyscaleThumb?image type=simple
Biosynthesis of unsaturated fatty acids (tetracosanoyl-CoA)PW002404 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Biosynthesis of unsaturated fatty acidsec01040 Map01040
SMPDB Reactions
Phytosphingosine + hexacosanoyl-CoAhydron + Coenzyme A + N-hexacosanoyl-C20-4-hydroxysphinganine
Phytosphingosine + Tetracosanoyl-CoA hydron + Coenzyme A + N-Tetracosanoylphytosphingosine
Phytosphingosine + Docosanoyl-CoAhydron + Coenzyme A + Cer 18:0;3/22:0;0
stearoyl-CoA + PhytosphingosineCoenzyme A + hydron + N-stearoylphytosphingosine
Eicosanoyl-CoA + Phytosphingosinehydron + Coenzyme A + N-icosanoylphytosphingosine
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB00045Coenzyme AShow
YMDB00285PhytosphingosineShow
YMDB00537hexacosanoyl-CoAShow
YMDB00538stearoyl-CoAShow
YMDB00862hydronShow
YMDB00909Tetracosanoyl-CoA Show
YMDB00963N-TetracosanoylphytosphingosineShow
YMDB01105Cer 18:0;3/22:0;0Show
YMDB16181Eicosanoyl-CoAShow
YMDB16242Docosanoyl-CoAShow
YMDB16301N-hexacosanoyl-C20-4-hydroxysphinganineShow
YMDB16307N-stearoylphytosphingosineShow
YMDB16308N-icosanoylphytosphingosineShow
GO Classification
Function
integral component of membrane
endoplasmic reticulum membrane
lipid metabolic process
Gene Properties
Chromosome LocationNot Available
Locus
Gene SequenceNot Available
Protein Properties
Pfam Domain FunctionNot Available
Protein ResiduesNot Available
Protein Molecular Weight17206.535
Protein Theoretical pINot Available
Signalling RegionsNot Available
Transmembrane Regions
  • 21-40
Protein Sequence>Ceramide synthase subunit LIP1 MSQPTPIITTKSAAKPKPKIFNLFRVCFISLLLIAAVEYFKYGTRINYEWFHCTPIKEPQ SGSVIKLWARGGPSCDKRGEYKTIVKRITRDYEPNDEHLSFCIIENDNVPPVHYPIHEDK GEPGYVAYVGYDTDSELVQELCADSTIYHM
References
External Links
ResourceLink
Saccharomyces Genome Database LIP1
Uniprot IDA6ZN14
Uniprot NameLIP1
General ReferenceNot Available